Molecule Information

General Information of the Molecule (ID: Mol02078)

Name	D-alanine ligase (vanD5) ,Enterococcus faecium
Synonyms	vanD; ddl; Tn6712_000090 Click to Show/Hide
Molecule Type	Protein
Gene Name	vanD5
Sequence	MFKIKVAVLFGGCSEEHNVSIKSAMEIAANIDTKKYQPYYIGITKSGVWKMCEKPCLEWE QYAGDPVVFSPDRNTHGLLIQKDTGYEIQPVDVVFPMIHGKFGEDGSIQGLLELSGIPYV GCDIQSSVICMDKALAYIVVKNAGIAVPGFRILQEGDRLETEDFVYPVFVKPARSGSSFG VNKVCKAEELQAAIEEARKYDSKILIEEAVTGSEVGCAILGNGNNLMAGEVDQIELRHGF FKIHQEAQPEKGSENAVIRVPAALPDEVRERIQKTAMKIYRILGCRGLARIDLFLREDGY IVLNEVNTMPGFTSYSRYPRMMTAAGFTLSEILDRLIELSLRR Click to Show/Hide
Function	Cell wall formation. Click to Show/Hide
Uniprot ID	A0A8F5Z8R9_ENTFC
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Bacilli Order: 186826 Family: Enterococcaceae Genus: Enterococcus Species: Enterococcus faecium

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Teicoplanin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Enterococcus faecium meningitis			[1]
Resistant Disease	Enterococcus faecium meningitis [ICD-11: 1D01.2]		Disease Info
Resistant Drug	Teicoplanin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Enterococcus faecium isolates		1352
Experiment for Molecule Alteration	Whole-genome sequencing assay
Experiment for Drug Resistance	Broth dilution assay
Mechanism Description	Glycopeptide (vancomycin and teicoplanin) resistance is attributed to the acquisition of vancomycin resistance (van) genes. Nine van genes that encode a D-Ala:D-Lac or D-Ala:D-Ser ligase (vanA, vanB, vanC, vanD, vanE, vanG, vanL, vanM and vanN) have been identified in Enterococcus spp. d-Alanyl:d-lactate (d-Ala:d-Lac) and d-alanyl:d-serine ligases are key enzymes in vancomycin resistance of Gram-positive cocci. They catalyze a critical step in the synthesis of modified peptidoglycan precursors that are low binding affinity targets for vancomycin.

References

Ref 1	Emergence of vancomycin- and teicoplanin-resistant Enterococcus faecium via vanD5-harbouring large genomic island .J Antimicrob Chemother. 2020 Sep 1;75(9):2411-2415. doi: 10.1093/jac/dkaa220. 10.1093/jac/dkaa220