Molecule Information

General Information of the Molecule (ID: Mol02074)

• Name: Chloramphenicol acetyltransferase (CAT) ,Clostridioides difficile
• Synonyms: catD
• Molecule Type: Protein
• Gene Name: CAT
• Sequence:
  MVFEKIDKNSWNRKEYFDHYFASVPCTYSMTVKVDITQIKEKGMKLYPAMLYYIAMIVNR
  HSEFRTAINQDGELGIYDEMIPSYTIFHNDTETFSSLWTECKSDFKSFLADYESDTQRYG
  NNHRMEGKPNAPENIFNVSMIPWSTFDGFNLNLQKGYDYLIPIFTMGKIIKKDNKIILPL
  AIQVHHAVCDGFHICRFVNELQELIIVTQVCL
• Function: This enzyme is an effector of chloramphenicol resistance in bacteria.
• Uniprot ID: CAT_CLODI

Kingdom: N.A.
Phylum: Firmicutes
Class: Clostridia
Order: Eubacteriales
Family: Peptostreptococcaceae
Genus: Clostridioides
Species: Clostridioides difficile

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Clostridium difficile infection [1]

• Resistant Disease: Clostridium difficile infection [ICD-11: 1A04.0]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• Mechanism Description: The inactivation of drug undergoes by the addition of side chain that generates a steric hindrance effect, which in turn disrupts the target-binding affinity. Two copies of catD gene encoding for CHL acetyltransferase locate at the mobile regions Tn4453a and Tn4453b of C. difficile. CHL acetyltransferase catalyses the relocation of acetyl group from acetyl-CoA to CHL, resulting in 3-O-acetyl CHL, which cannot bind to a ribosome and loses its antimicrobial action.

References

• Ref 1: Insights into drug resistance mechanisms in Clostridium difficile .Essays Biochem. 2017 Mar 3;61(1):81-88. doi: 10.1042/EBC20160062. Print 2017 Feb 28. 10.1042/EBC20160062