Molecule Information

General Information of the Molecule (ID: Mol02066)

• Name: Cuticle protein (TERG_08771 ) ,Trichophyton rubrum
• Synonyms: TERG_08771
• Molecule Type: Protein
• Gene Name: TERG_08771
• Sequence:
  MKASIGALALLLAQQASAAYIPSGSAKGSTLVRRDWGGLDGSQFVDPGNQPSCPECGGDG
  GEPQCPDGNCGGGEPQCPNGNCGGGIGGNIGGGIGGGIGGGIGGGIGGGIGGGIGGGIGG
  GIGGGGGDCWGGDDGLPPPCYPVPGNTPPDCTPEQENGFDFIDLIEGAINFFGGCDFSGF
  TCVDGIVKGALEVGGKVITALLRAGGDNIPTISKSNGGLAIVSIEAYAEVDVDIVLVFTM
  PDGSICRQFASCSPAGQTIMNEQCGGATSVGFHLAVHSKVSVCAVVIKKINFGCEPPTIP
  TWPFPPLPFPTTSLPPPETSGGYTTIPGTSESGSWSSMPSSYSMPTSGYTTVPGTSSPHS
  TPSGGFPTSSGGIPGQTTVPTSPAPTTWTSQSISTIYTTSTMTITSCPPEVPDCPTGSTT
  VITSTIPDNPDSQVSQVSQDSPVSLDSLDSQVSQDSQDSQVSLDSQDSQDSQDSQVSLDS
  QDNQVSLDSQVSLDSQVSQDSQDSQDSQDSQDSQDSQVSLDSQVNPDSQVSLDSQVNPDS
  QVSQDSLDNQVSQVSLDSQDSQVNQVSLDSQVSLDSQDNQVSLDSQVSLDSQVSLDSQDS
  QDSQDSQDSLDSQVNPDSQVSLDSQVNPDSQVSQDSQVSLDSQDSQDSQDSQVSLDSQDN
  QVSLDSQVSLDSQVSLDSQDSQDSQDSQVSLDSQVNPDSQVSLDSQVNPDSQVSQDSLDN
  QVSQVSLDSQDSQVNQVSQVSLDNPDSQVSQDNPVSQDSLDSQVNQVSQDSQCLIHQSFP
  DCDSNSHITCLCPSSEFAHKVIECIRAWSDDEKETQAALSFFLGICVTYIPKNPGLTDNL
  PPGIPIAPTSAPNGPAPPAVTVIITPTATGNHTVPPTTIVIPTVSFTTPTSGASHQAPYP
  VPAAPTSDGGSAPTPAPGGVPAPTPPYGSTGFMTVSPTGGVPHPTSTTEPYIGAASSVEA
  FLSQWVMMGITAMVGLIQFAL
• Uniprot ID: F2SMI7_TRIRC

Kingdom: Fungi
Phylum: Ascomycota
Class: Eurotiomycetes
Order: Onygenales
Family: Arthrodermataceae
Genus: Trichophyton
Species: Trichophyton rubrum

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Voriconazole

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Tinea capitis [1]

• Resistant Disease: Tinea capitis [ICD-11: 1F28.0]
• Resistant Drug: Voriconazole
• Molecule Alteration: SNP; .
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Trichophyton rubrum isolates; 5551
• Experiment for Drug Resistance: Broth dilution method assay
• Mechanism Description: The gene TERG_08771 harboring the highest SNPs density is found to be associated with resistance to voriconazole.

Disease Class: Tinea corporis [1]

• Resistant Disease: Tinea corporis [ICD-11: 1F28.Y]
• Resistant Drug: Voriconazole
• Molecule Alteration: SNP; .
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Trichophyton rubrum isolates; 5551
• Experiment for Drug Resistance: Broth dilution method assay
• Mechanism Description: The gene TERG_08771 harboring the highest SNPs density is found to be associated with resistance to voriconazole.

Disease Class: Tinea inguinalis [1]

• Resistant Disease: Tinea inguinalis [ICD-11: 1F28.4]
• Resistant Drug: Voriconazole
• Molecule Alteration: SNP; .
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Trichophyton rubrum isolates; 5551
• Experiment for Drug Resistance: Broth dilution method assay
• Mechanism Description: The gene TERG_08771 harboring the highest SNPs density is found to be associated with resistance to voriconazole.

Disease Class: Tinea manus [1]

• Resistant Disease: Tinea manus [ICD-11: 1F28.5]
• Resistant Drug: Voriconazole
• Molecule Alteration: SNP; .
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Trichophyton rubrum isolates; 5551
• Experiment for Drug Resistance: Broth dilution method assay
• Mechanism Description: The gene TERG_08771 harboring the highest SNPs density is found to be associated with resistance to voriconazole.

Disease Class: Tinea pedis [1]

• Resistant Disease: Tinea pedis [ICD-11: 1F28.2]
• Resistant Drug: Voriconazole
• Molecule Alteration: SNP; .
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Trichophyton rubrum isolates; 5551
• Experiment for Drug Resistance: Broth dilution method assay
• Mechanism Description: The gene TERG_08771 harboring the highest SNPs density is found to be associated with resistance to voriconazole.

Disease Class: Tinea unguium [1]

• Resistant Disease: Tinea unguium [ICD-11: 1F28.1]
• Resistant Drug: Voriconazole
• Molecule Alteration: SNP; .
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Trichophyton rubrum isolates; 5551
• Experiment for Drug Resistance: Broth dilution method assay
• Mechanism Description: The gene TERG_08771 harboring the highest SNPs density is found to be associated with resistance to voriconazole.

References

• Ref 1: Whole-genome resequencing of Trichophyton rubrum provides insights into population differentiation and drug resistance .Mycopathologia. 2020 Feb;185(1):103-112. doi: 10.1007/s11046-019-00384-1. Epub 2019 Sep 19. 10.1007/s11046-019-00384-1