Molecule Information

General Information of the Molecule (ID: Mol02049)

Name	Bifunctional dihydrofolate reductase-thymidylate synthase (PVDHFR) ,Plasmodium vivax
Synonyms	dhfr; dfhr Click to Show/Hide
Molecule Type	Protein
Gene Name	Pvdhfr
Sequence	MEDLSDVFDIYAICACCKVAPTSEGTKNEPFSPRTFRGLGNKGTLPWKCNSVDMKYFRSV TTYVDESKYEKLKWKRERYLRMEASQGGGDNTSGGDNTHGGDNADKLQNVVVMGRSNWES IPKQYKPLPNRINVVLSKTLTKEDVKEKVFIIDSIDDLLLLLKKLKYYKCFIIGGAQVYR ECLSRNLIKQIYFTRIN Click to Show/Hide
Function	Bifunctional enzyme. Involved in de novo dTMP biosynthesis. Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, DNA precursor synthesis, and for the conversion of dUMP to dTMP. Click to Show/Hide
Uniprot ID	Q0PW60_PLAVI
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Apicomplexa Class: Aconoidasida Order: Haemosporida Family: Plasmodiidae Genus: Plasmodium Species: Plasmodium vivax

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Pyrimethamine/Sulfadoxine

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)			Click to Show/Hide
Disease Class: Plasmodium vivax malaria				[1]
Resistant Disease	Plasmodium vivax malaria [ICD-11: 1F41.0]			Disease Info
Resistant Drug	Pyrimethamine/Sulfadoxine			Drug Info
Molecule Alteration	SNP		.
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Red blood cells	Blood	Homo sapiens (Human)	N.A.
Experiment for Molecule Alteration	Whole genome sequencing assay
Experiment for Drug Resistance	Giemsa stain assay
Mechanism Description	The lack of copy number variation of pvgch1 suggests that SP-resistant P. vivax may harbor alternative mechanisms to secure sufficient folate.The quadruple mutant haplotypes 57I/L/58R/61M/117T of pvdhfr gene were the most common (comprising 76% of cases in Myitsone and 43.7% of case in Laiza). The double mutant haplotype 383G/553G of pvdhps gene was also prevalent at each site.

References

Ref 1	Polymorphism of Antifolate Drug Resistance in Plasmodium vivax From Local Residents and Migrant Workers Returned From the China-Myanmar Border .Front Cell Infect Microbiol. 2021 Jun 24;11:683423. doi: 10.3389/fcimb.2021.683423. eCollection 2021. 10.3389/fcimb.2021.683423