Molecule Information

General Information of the Molecule (ID: Mol02035)

Name	Vimentin 2, pseudogene (VIM2P) ,Pseudomonas aeruginosa
Synonyms	vim2 Click to Show/Hide
Molecule Type	Protein
Gene Name	VIM2P
Sequence	MGLPVTRAVSTHFHDDRSPLLGVLRVSGVATYSPPSPRRLAEVEGNEIPTHSLEGLSSSE VQLPFHPL Click to Show/Hide
Uniprot ID	V9W1K1_PSEAI
HGNC ID	HGNC:43891
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: 72274 Family: Pseudomonadaceae Genus: Pseudomonas Species: Pseudomonas aeruginosa

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Edetic acid

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection			[1]
Sensitive Disease	Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]		Disease Info
Sensitive Drug	Edetic acid		Drug Info
Molecule Alteration	Function	Inhibition
Experimental Note	Discovered Using In-vivo Testing Model
Experiment for Molecule Alteration	Molecular modeling assay
Experiment for Drug Resistance	Double-disk diffusion test assay
Mechanism Description	Disk diffusion and broth microdilution methods demonstrate that unithiol inhibits native MBLs NDM-1 and VIM-2 produced by carbapenem-resistant K. pneumoniae and P. aeruginosa bacterial strains.

Unithiol

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)			Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection				[1]
Sensitive Disease	Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]			Disease Info
Sensitive Drug	Unithiol			Drug Info
Molecule Alteration	Function		Inhibition
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Schistosoma mansoni isolates			6183
	SH-1-V1 cells	Esophagus	Homo sapiens (Human)	N.A.
Experiment for Molecule Alteration	Molecular modeling assay
Experiment for Drug Resistance	Double-disk diffusion test assay
Mechanism Description	Disk diffusion and broth microdilution methods demonstrate that unithiol inhibits native MBLs NDM-1 and VIM-2 produced by carbapenem-resistant K. pneumoniae and P. aeruginosa bacterial strains.

References

Ref 1	Drug Repurposing of the Unithiol: Inhibition of Metallo-Beta-Lactamases for the Treatment of Carbapenem-Resistant Gram-Negative Bacterial Infections .Int J Mol Sci. 2022 Feb 6;23(3):1834. doi: 10.3390/ijms23031834. 10.3390/ijms23031834