Molecule Information

General Information of the Molecule (ID: Mol02027)

Name	Ribosomal tetracycline resistance protein tet (TET(44)) ,Clostridioides difficile
Synonyms	BGV00_19340; BN1095_620053; BN1096_520088; BN1097_680096; E5F26_13010; E5F27_11275; E5F28_08645; E5F29_03080; E5F30_14860; E5F31_09375; E5F32_08895; E5F33_19320; E5F34_11670; E5F35_02795; E5F36_15070; E5F37_19425; E5F38_19050; E5F39_10665; E5F40_01415; E5F41_11825; E5F42_18275; E5F43_02490; E5F44_06595; E5F45_10465 Click to Show/Hide
Molecule Type	Protein
Gene Name	TET(44)
Gene ID	66355013
Sequence	MKTNNMKQAILSSATNLIAKNGVQNTSLADIAKDVNISKGTLYYHYASKDDIIYDIADTH LEVITSAILNCVKNVKSKNSQIEMVNLILEKISTIESRGRVHMYLICEAITSNNDLKERI RLKYIEWRTTLKSEIVESLEKYNSSENEQDAESFSFLLMSIVDGLVVQSLLKTEKIPYEN IASFLVNHWI Click to Show/Hide
Uniprot ID	A0A031WAZ8_CLODI
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Clostridia Order: Eubacteriales Family: Peptostreptococcaceae Genus: Clostridioides Species: Clostridioides difficile

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Tetracycline

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Human immunodeficiency virus infection			[1]
Resistant Disease	Human immunodeficiency virus infection [ICD-11: 1C62.0]		Disease Info
Resistant Drug	Tetracycline		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
Mechanism Description	Of the resistance mechanisms, C. difficile produces ribosomal protection protein that impedes the attachment of the drug to a ribosome. The TetM protein that functions as ribosomal protectant has been identified in TET-resistant C. difficile strains, whereas the presence of other Tet proteins such as Tet(W) and Tet(44) has also been recognized. The TetM exhibits homology to EF-G and shares the same binding region in a ribosome. The binding of the TetM protein to a ribosome accompanying with the GTP hydrolysis allows conformational change of the ribosome, resulting in the dissociation of TET from its binding site. Cellular protein synthesis is then recovered through the binding of EF-G after the release of hydrolysed TetM.

References

Ref 1	Insights into drug resistance mechanisms in Clostridium difficile .Essays Biochem. 2017 Mar 3;61(1):81-88. doi: 10.1042/EBC20160062. Print 2017 Feb 28. 10.1042/EBC20160062