Molecule Information

General Information of the Molecule (ID: Mol02024)

Name	Metallo-beta-lactamase type 2 (BLAN1) ,Klebsiella pneumoniae
Synonyms	blaNDM-1 Click to Show/Hide
Molecule Type	Protein
Gene Name	BLAN1
Gene ID	61419528
Sequence	MELPNIMHPVAKLSTALAAALMLSGCMPGEIRPTIGQQMETGDQRFGDLVFRQLAPNVWQ HTSYLDMPGFGAVASNGLIVRDGGRVLVVDTAWTDDQTAQILNWIKQEINLPVALAVVTH AHQDKMGGMDALHAAGIATYANALSNQLAPQEGMVAAQHSLTFAANGWVEPATAPNFGPL KVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLGDADTEHYAASARAFGAAF PKASMIVMSHSAPDSRAAITHTARMADKLR Click to Show/Hide
Function	Confers resistance to the different beta-lactams antibiotics (penicillin, cephalosporin and carbapenem) via the hydrolysis of the beta-lactam ring. Does not confer resistance to the polymixin colistin or the fluoroquinolone ciprofloxacin. Click to Show/Hide
Uniprot ID	BLAN1_KLEPN
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: 91347 Family: Enterobacteriaceae Genus: Klebsiella Species: Klebsiella pneumoniae

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Edetic acid

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Klebsiella pneumoniae infection			[1]
Sensitive Disease	Klebsiella pneumoniae infection [ICD-11: CA40.1]		Disease Info
Sensitive Drug	Edetic acid		Drug Info
Molecule Alteration	Function	Inhibition
Experimental Note	Discovered Using In-vivo Testing Model
Experiment for Molecule Alteration	Molecular modeling assay
Experiment for Drug Resistance	Double-disk diffusion test assay
Mechanism Description	Disk diffusion and broth microdilution methods demonstrate that unithiol inhibits native MBLs NDM-1 and VIM-2 produced by carbapenem-resistant K. pneumoniae and P. aeruginosa bacterial strains.

Unithiol

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Klebsiella pneumoniae infection			[1]
Sensitive Disease	Klebsiella pneumoniae infection [ICD-11: CA40.1]		Disease Info
Sensitive Drug	Unithiol		Drug Info
Molecule Alteration	Function	Inhibition
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Klebsiella pneumoniae strain 409		573
	Klebsiella pneumoniae strain 410		573
Experiment for Molecule Alteration	Molecular modeling assay
Experiment for Drug Resistance	Double-disk diffusion test assay
Mechanism Description	Disk diffusion and broth microdilution methods demonstrate that unithiol inhibits native MBLs NDM-1 and VIM-2 produced by carbapenem-resistant K. pneumoniae and P. aeruginosa bacterial strains.

References

Ref 1	Drug Repurposing of the Unithiol: Inhibition of Metallo-Beta-Lactamases for the Treatment of Carbapenem-Resistant Gram-Negative Bacterial Infections .Int J Mol Sci. 2022 Feb 6;23(3):1834. doi: 10.3390/ijms23031834. 10.3390/ijms23031834