Molecule Information

General Information of the Molecule (ID: Mol01950)

• Name: Glial fibrillary acidic protein (GFAP) ,Mus musculus
• Synonyms: Gfap
• Molecule Type: Protein
• Gene Name: GFAP
• Gene ID: 14580
• Location: chr11:102,778,162-102,791,738[-]
• Sequence:
  MERRRITSARRSYASETVVRGLGPSRQLGTMPRFSLSRMTPPLPARVDFSLAGALNAGFK
  ETRASERAEMMELNDRFASYIEKVRFLEQQNKALAAELNQLRAKEPTKLADVYQAELREL
  RLRLDQLTANSARLEVERDNFAQDLGTLRQKLQDETNLRLEAENNLAAYRQEADEATLAR
  VDLERKVESLEEEIQFLRKIYEEEVRELREQLAQQQVHVEMDVAKPDLTAALREIRTQYE
  AVATSNMQETEEWYRSKFADLTDAASRNAELLRQAKHEANDYRRQLQALTCDLESLRGTN
  ESLERQMREQEERHARESASYQEALARLEEEGQSLKEEMARHLQEYQDLLNVKLALDIEI
  ATYRKLLEGEENRITIPVQTFSNLQIRETSLDTKSVSEGHLKRNIVVKTVEMRDGEVIKD
  SKQEHKDVVM
• Function: GFAP, a class-III intermediate filament, is a cell-specific marker that, during the development of the central nervous system, distinguishes astrocytes from other glial cells.
• Uniprot ID: GFAP_MOUSE
• Ensembl ID: ENSMUSG00000020932
• HGNC ID: HGNC:4235

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: 9989
Family: Muridae
Genus: Mus
Species: Mus musculus

Type(s) of Resistant Mechanism of This Molecule

  RTDM: Regulation by the Disease Microenvironment

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Rabeprazole

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms

Regulation by the Disease Microenvironment (RTDM)

Disease Class: Glioma [1]

• Sensitive Disease: Glioma [ICD-11: 2A00.1]
• Sensitive Drug: Rabeprazole
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• Cell Pathway Regulation: AKT/GSK3beta signaling pathway; Inhibition; hsa04931
• Cell Pathway Regulation: NF-KappaB signaling pathway; Inhibition; hsa04064
• In Vitro Model: MDA-231 cells; Pleural effusion; Homo sapiens (Human); CVCL_0062
• In Vitro Model: MJ cells; Peripheral blood; Homo sapiens (Human); CVCL_1414
• In Vitro Model: MMQ cells; Pituitary gland; Rattus norvegicus (Rat); CVCL_2117
• In Vitro Model: MOLM-13 cells; Peripheral blood; Homo sapiens (Human); CVCL_2119
• In Vivo Model: Male Wistar rats-Stereotaxic glioma model; Rattus norvegicus
• Experiment for Molecule Alteration: Western blotting analysis; Gene expression analysis
• Experiment for Drug Resistance: MTT assay; Scratch wound healing migration assay; Transwell invasion assay
• Mechanism Description: Epithelial to mesenchymal transition (EMT) is pivotal in embryonic development and wound healing, whereas in cancer it inflicts malignancy and drug resistance. Rabeprazole has efficacy per se and reduces resistance to temozolomide in glioma via EMT inhibition. Rabeprazole suppressed EMT by impeding AKT/GSK3beta phosphorylation and/or NF-kappaB signaling and sensitized temozolomide resistance.

References

• Ref 1: Rabeprazole has efficacy per se and reduces resistance to temozolomide in glioma via EMT inhibition .Cell Oncol (Dordr). 2021 Aug;44(4):889-905. doi: 10.1007/s13402-021-00609-w. Epub 2021 May 4. 10.1007/s13402-021-00609-w