Molecule Information

General Information of the Molecule (ID: Mol01908)

• Name: Prostaglandin E2 receptor EP3 subtype (PE2R3) ,Homo sapiens
• Synonyms: PTGER3
• Molecule Type: Protein
• Gene Name: PE2R3
• Gene ID: 5733
• Location: chr1:70,852,353-71,047,816[-]
• Sequence:
  MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVAFPITMLL
  TGFVGNALAMLLVSRSYRRRESKRKKSFLLCIGWLALTDLVGQLLTTPVVIVVYLSKQRW
  EHIDPSGRLCTFFGLTMTVFGLSSLFIASAMAVERALAIRAPHWYASHMKTRATRAVLLG
  VWLAVLAFALLPVLGVGQYTVQWPGTWCFISTGRGGNGTSSSHNWGNLFFASAFAFLGLL
  ALTVTFSCNLATIKALVSRCRAKATASQSSAQWGRITTETAIQLMGIMCVLSVCWSPLLI
  MMLKMIFNQTSVEHCKTHTEKQKECNFFLIAVRLASLNQILDPWVYLLLRKILLRKFCQI
  RYHTNNYASSSTSLPCQCSSTLMWSDHLER
• Function: Receptor for prostaglandin E2 (PGE2). The activity of this receptor can couple to both the inhibition of adenylate cyclase mediated by G(i) proteins, and to an elevation of intracellular calcium. Required for normal development of fever in response to pyrinogens, including IL1B, prostaglandin E2 and bacterial lipopolysaccharide (LPS). Required for normal potentiation of platelet aggregation by prostaglandin E2, and thus plays a role in the regulation of blood coagulation. Required for increased HCO3(-) secretion in the duodenum in response to mucosal acidification, and thereby contributes to the protection of the mucosa against acid-induced ulceration. Not required for normal kidney function, normal urine volume and osmolality.
• Uniprot ID: PE2R3_HUMAN
• Ensembl ID: ENSG00000050628

Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Fotemustine

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Endometriosis [1]

• Resistant Disease: Endometriosis [ICD-11: GA10.0]
• Resistant Drug: Fotemustine
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• Cell Pathway Regulation: MAPK signaling pathway; Activation; hsa04010
• In Vivo Model: Female Sprague-Dawley rats model; Rattus norvegicus
• Experiment for Molecule Alteration: Western blotting analysis
• Mechanism Description: Fotemustine and dexamethasone administration had anti-apoptotic activity, restoring the impaired mechanism (TUNEL assay and Western blot analysis of Bax and Bcl-2). Moreover, no gastric disfunction was detected (histological analysis of stomachs). Thus, our data showed that the combined therapy of fotemustine and dexamethasone reduced endometriosis-induced inflammation, hyperproliferation and apoptosis resistance.

Disease- and Tissue-specific Abundances of This Molecule

ICD Disease Classification 16

Endometriosis [ICD-11: GA10]

Differential expression of molecule in resistant diseases

• The Studied Tissue: Endometrium
• The Specified Disease: Endometriosis
• The Expression Level of Disease Section Compare with the Healthy Individual Tissue: p-value: 8.85E-02; Fold-change: 1.20E-01; Z-score: 5.06E-01

References

• Ref 1: Regulation of Inflammatory and Proliferative Pathways by Fotemustine and Dexamethasone in Endometriosis .Int J Mol Sci. 2021 Jun 1;22(11):5998. doi: 10.3390/ijms22115998. 10.3390/ijms22115998