Molecule Information

General Information of the Molecule (ID: Mol01203)

Name	Aminoglycoside N(3)-acetyltransferase (AACC2) ,Pseudomonas aeruginosa
Molecule Type	Protein
Gene Name	AAC(3)-IIa
Sequence	MHTQKAITEALQKLGVQSGDLLMVHASLKSIGPVEGGAETVVAALRSAVGPTGTVMGYAS WDRSPYEETLNGARLDDNARRTWPPFDPATAGTYRGFGLLNQFLVQAPGARRSAHPDASM VAVGPLAETLTEPHELGHALGEGSPNERFVRLGGKALLLGAPLNSVTALHYAEAVADIPN KRWVTYEMPMPGRDGEVAWKTASDYDSNGILDCFAIEGKQDAVETIANAYVKLGRHREGV VGFAQCYLFDAQDIVTFGVTYLEKHFGTTPIVPAHEAIERSCEPSG Click to Show/Hide
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Pseudomonadales Family: Pseudomonadaceae Genus: Pseudomonas Species: Pseudomonas aeruginosa

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

2 drug(s) in total

Click to Show/Hide the Full List of Drugs

Gentamicin B

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2], [3]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Gentamicin B		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli HB101		634468
	Pseudomonas aeruginosa PAe1100		287
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Agar dilution method assay
Mechanism Description	The AAC(3)-II AGRP is characterized by resistance to gentamicin, tobramycin, dibekacin, netilmicin, 2'-N-ethylnetilmicin, 6'-N-ethylnetilmicin, and sisomicin.

Gentamicin C

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2], [3]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Gentamicin C		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli HB101		634468
	Pseudomonas aeruginosa PAe1100		287
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Agar dilution method assay
Mechanism Description	The AAC(3)-II AGRP is characterized by resistance to gentamicin, tobramycin, dibekacin, netilmicin, 2'-N-ethylnetilmicin, 6'-N-ethylnetilmicin, and sisomicin.

References

Ref 1	Genes for gentamicin-(3)-N-acetyl-transferases III and IV. II. Nucleotide sequences of three AAC(3)-III genes and evolutionary aspects. Mol Gen Genet. 1985;198(3):514-20. doi: 10.1007/BF00332949.
Ref 2	Molecular genetics of aminoglycoside resistance genes and familial relationships of the aminoglycoside-modifying enzymes. Microbiol Rev. 1993 Mar;57(1):138-63. doi: 10.1128/mr.57.1.138-163.1993.
Ref 3	A TEM-derived extended-spectrum beta-lactamase in Pseudomonas aeruginosa. Antimicrob Agents Chemother. 1996 Nov;40(11):2488-93. doi: 10.1128/AAC.40.11.2488.