Molecule Information

General Information of the Molecule (ID: Mol01135)

Name	Virginiamycin B lyase (VGBB) ,Staphylococcus cohnii
Synonyms	Streptogramin B lyase Click to Show/Hide
Molecule Type	Protein
Gene Name	vgbB
Sequence	MNFYLEEFNLSIPDSGPYGITSSEDGKVWFTQHKANKISSLDQSGRIKEFEVPTPDAKVM CLIVSSLGDIWFTENGANKIGKLSKKGGFTEYPLPQPDSGPYGITEGLNGDIWFTQLNGD RIGKLTADGTIYEYDLPNKGSYPAFITLGSDNALWFTENQNNSIGRITNTGKLEEYPLPT NAAAPVGITSGNDGALWFVEIMGNKIGRITTTGEISEYDIPTPNARPHAITAGKNSEIWF TEWGANQIGRITNDKTIQEYQLQTENAEPHGITFGKDGSVWFALKCKIGKLNLNE Click to Show/Hide
Function	Inactivates the type B streptogramin antibiotics by linearizing the lactone ring at the ester linkage, generating a free phenylglycine carboxylate and converting the threonyl moiety into 2-amino-butenoic acid. Click to Show/Hide
Uniprot ID	O87275_9STAP
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Bacilli Order: Bacillales Family: Staphylococcaceae Genus: Staphylococcus Species: Staphylococcus cohnii

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Investigative Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Quinupristin/Dalfopristin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Staphylococcus aureus infection			[1]
Resistant Disease	Staphylococcus aureus infection [ICD-11: 1B54.0]		Disease Info
Resistant Drug	Quinupristin/Dalfopristin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli BL21(DE3)		469008
Experiment for Molecule Alteration	PCR amplification and sequence alignments assay
Experiment for Drug Resistance	Spectrophotometric and fluorometric assay
Mechanism Description	Virginiamycin B lyase (Vgb) inactivates the quinupristin component of Synercid by lactone ring opening and the enzyme promotes this reaction by intramolecular Beta-elimination without the involvement of a water molecule. Replacement of the conserved active site residues His228, Glu268, or His270 with alanine reduces or abolishes S. cohnii Vgb activity. Residue Lys285 in S. cohnii Vgb is spatially equivalent to the S. aureus Vgb active site residue Glu284.

References

Ref 1	Crystal structure and mechanism of the Staphylococcus cohnii virginiamycin B lyase (Vgb). Biochemistry. 2008 Apr 8;47(14):4257-65. doi: 10.1021/bi7015266. Epub 2008 Mar 15.