Molecule Information

General Information of the Molecule (ID: Mol01132)

• Name: Undecaprenyl-diphosphatase (UPPP) ,Enterococcus faecalis
• Synonyms: Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase; bacA; upk; EF_2439
• Molecule Type: Protein
• Gene Name: uppP
• Sequence:
  MLFANLWKAIILGIIEGITEWLPISSTGHLILVDEFIKLDLSKDFMEMFNVVIQLGAIMA
  VVILYFHKLNPFSPKKNGEEKKDTWILWSKVLVACLPAAVIGLKFDDYLDAHFYNFLTVS
  IMLIVYGIAFIIIEKRNKNVAPKCTNLKDFTYKAALIVGAFQVLALIPGTSRSGATILGA
  ILIGASRFVATEFSFFLGIPVMFGASFLKIFKFLAKGNTFGSEEIIILITGSIVAFVVSI
  IAIKFLLNYLKKNDFTVFGWYRVILGAILIGYWLFS
• Function: Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP). Confers resistance to bacitracin (By similarity).
• Uniprot ID: UPPP1_ENTFA

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus faecalis

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 3 drug(s) in total

Bacitracin A

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Bacitracin A
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli DH10B; 316385
• In Vitro Model: Enterococcus faecalis JH2-2; 1351
• In Vitro Model: Enterococcus faecalis V583; 226185
• In Vitro Model: Escherichia coli MC1061; 1211845
• Experiment for Molecule Alteration: Whole genome sequence assay; Allelic frequency measurement assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: Binding of bacitracin to UPP prevents its dephosphorylation, thereby disrupting the regeneration of UP.Depletion of the available carrier lipids leads to the inhibition of the cell wall synthesis, resulting eventually in cell death.Low-level bacitracin resistance in E. faecalis is mediated by a BacA-type UppP.

Bacitracin F

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Bacitracin F
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli DH10B; 316385
• In Vitro Model: Enterococcus faecalis JH2-2; 1351
• In Vitro Model: Enterococcus faecalis V583; 226185
• In Vitro Model: Escherichia coli MC1061; 1211845
• Experiment for Molecule Alteration: Whole genome sequence assay; Allelic frequency measurement assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: Binding of bacitracin to UPP prevents its dephosphorylation, thereby disrupting the regeneration of UP.Depletion of the available carrier lipids leads to the inhibition of the cell wall synthesis, resulting eventually in cell death.Low-level bacitracin resistance in E. faecalis is mediated by a BacA-type UppP.

Bacitracin methylene disalicylate

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Bacitracin methylene disalicylate
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli DH10B; 316385
• In Vitro Model: Enterococcus faecalis JH2-2; 1351
• In Vitro Model: Enterococcus faecalis V583; 226185
• In Vitro Model: Escherichia coli MC1061; 1211845
• Experiment for Molecule Alteration: Whole genome sequence assay; Allelic frequency measurement assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: Binding of bacitracin to UPP prevents its dephosphorylation, thereby disrupting the regeneration of UP.Depletion of the available carrier lipids leads to the inhibition of the cell wall synthesis, resulting eventually in cell death.Low-level bacitracin resistance in E. faecalis is mediated by a BacA-type UppP.

References

• Ref 1: Undecaprenyl pyrophosphate phosphatase confers low-level resistance to bacitracin in Enterococcus faecalis. J Antimicrob Chemother. 2013 Jul;68(7):1583-93. doi: 10.1093/jac/dkt048. Epub 2013 Mar 3.