Molecule Information

General Information of the Molecule (ID: Mol01126)

• Name: Tylosin resistance ATP-binding protein TlrC (TLRC) ,Streptomyces fradiae
• Molecule Type: Protein
• Gene Name: tlrC
• Sequence:
  MRTSPSSQLSLHGVTKRYDDRVVLSQVSLAISPGEKAGIIGDNGAGKSTLLRLLAGEERP
  DAGEVTVIAPGGVGYLPQTLGLPPRATVQDAIDLAMTELRVLEAELRRTEAALAEAATDE
  ALQDALTAYARLTEQYEVRDGYGADARVDAALHGLGLPGLPRDRRLGTLSGGERSRLALA
  ATLASQPELLLLDEPTNDLDDRAVHWLEEHLSGHRGTVVTVTHDRVFLDRLTATVLEVDG
  RGVSRHGDGYAGYLAAKAAERRRRQQQYDEWRAELDRNRRLAEANVARLDGIPRKMGKAA
  FGHGAFRARGRDHGAMSRVRNAKERVERLTANPVAPPADRLSLTARIATADGPGEAPAAE
  LDGVVVGSRLRVPKLRLGAAERLLITGPNGAGKSTLLSVLAGELSPDAGAVSVPGRVGHL
  RQEETPWPAKLTVLEAFAHNRPGDRDEQADRRLSLGLFEPEALRLRVGELSYGQRRRIEL
  ARLVSEPVGLLLLDEPTNHLSPALVEELEEALTGYGGALVLVTHDRRMRSRFTGSHLELR
  EGVVSGAR
• Function: Responsible for tylosin resistance, and is proposed to be a subunit of a multicomponent export system for the energy-dependent efflux of tylosin.
• Uniprot ID: TLRC_STRFR

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces fradiae

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Macrolides

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Streptomyces fradiae infection [1]

• Resistant Disease: Streptomyces fradiae infection [ICD-11: 1C43.5]
• Resistant Drug: Macrolides
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Streptomyces fradiae strain; 1906
• In Vitro Model: Treptomyces fradia strain; 1906
• Experiment for Molecule Alteration: Northern blotting analysis
• Mechanism Description: A tylosin(Ty)-producing strain of Streptomyces fradiae contains at least three genes, tlrA, tlrB, tlrC, specifying resistance to Ty (TyR).

Disease Class: Streptomyces fradiae infection [1]

• Resistant Disease: Streptomyces fradiae infection [ICD-11: 1C43.5]
• Resistant Drug: Macrolides
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Streptomyces fradiae strain; 1906
• In Vitro Model: Treptomyces fradia strain; 1906
• Experiment for Molecule Alteration: Northern blotting analysis
• Mechanism Description: The product of the tlrA gene is an rRNA methylase responsible for dimethylation of a specific A residue in S. fradiae 23s rRNA (Zalacain and Cundliffe, 1989). In contrast, the Ty-inducible resistance encoded by tlrB or tlrC appears to be specific for Ty and each imparts lower levels of TyR than does tlrA.

References

• Ref 1: Homology between proteins controlling Streptomyces fradiae tylosin resistance and ATP-binding transport. Gene. 1991 Jun 15;102(1):27-32. doi: 10.1016/0378-1119(91)90533-h.