Molecule Information

General Information of the Molecule (ID: Mol01117)

• Name: Tetracycline resistance protein TetW (TETW) ,Butyrivibrio fibrisolvens
• Synonyms: Tet(W); tet(W)
• Molecule Type: Protein
• Gene Name: tetW
• Gene ID: 64114426
• Sequence:
  MKIINIGILAHVDAGKTTLTESLLYASGAISEPGSVEKGTTRTDTMFLERQRGITIQAAV
  TSFQWHRCKVNIVDTPGHMDFLAEVYRSLAVLDGAILVISAKDGVQAQTRILFHALRKMN
  IPTVIFINKIDQAGVDLQSVVQSVRDKLSADIIIKQTVSLSPEIVLEENTDIEAWDAVIE
  NNDELLEKYIAGEPISREKLAREEQQRVQDASLFPVYHGSAKNGLGIQPLMDAVTGLFQP
  IGEQGGAALCGSVFKVEYTDCGQRRVYLRLYSGTLRLRDTVALAGREKLKITEMRIPSKG
  EIVRTDTAYQGEIVILPSDSVRLNDVLGDQTRLPRKRWREDPLPMLRTTIAPKTAAQRER
  LLDALTQLADTDPLLRCEVDSITHEIILSFLGRVQLEVVSALLSEKYKLETVVKEPSVIY
  MERPLKAASHTIHIEVPPNPFWASIGLSVTPLSLGSGVQYESRVSLGYLNQSFQNAVRDG
  IRYGLEQGLFGWNVTDCKICFEYGLYYSPVSTPADFRSLAPIVLEQALKESGTQLLEPYL
  SFILYAPQEYLSRAYHDAPKYCATIETAQVKKDEVVFTGEIPARCIQAYRTDLAFYTNGR
  SVCLTELKGYQAAVGQPVIQPRRPNSRLDKVRHMFQKVM
• Function: Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
• Uniprot ID: TETW_BUTFI

Kingdom: N.A.
Phylum: Firmicutes
Class: Clostridia
Order: Eubacteriales
Family: Lachnospiraceae
Genus: Butyrivibrio
Species: Butyrivibrio fibrisolvens

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Tetracycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Butyrivibrio fibrisolvens infection [1]

• Resistant Disease: Butyrivibrio fibrisolvens infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Tetracycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Bifidobacterium longum strain F10; 216816
• In Vitro Model: Bifidobacterium longum strain F5; 216816
• In Vitro Model: Bifidobacterium longum strain F8; 216816
• In Vitro Model: Butyrivibrio fibrisolvens strain 1.23; 831
• In Vitro Model: Butyrivibrio fibrisolvens strain 1.230; 831
• In Vitro Model: Butyrivibrio fibrisolvens strain Jk214; 831
• In Vitro Model: Butyrivibrio fibrisolvens strain Jk51; 831
• In Vitro Model: Fusobacterium prausnitzii strain k10; 853
• In Vitro Model: Mitsuokella multiacidus strain 46/5(2); 52226
• In Vitro Model: Mitsuokella multiacidus strain P208-58; 52226
• In Vitro Model: Selenomonas ruminantium strain FB32; 971
• In Vitro Model: Selenomonas ruminantium strain FB322; 971
• In Vitro Model: Selenomonas ruminantium strain FB34; 971
• Experiment for Molecule Alteration: Southern blotting assay
• Mechanism Description: Members of our group recently identified a new tetracycline resistance gene, tet(W), in three genera of rumen obligate anaerobes. Here, we show that tet(W) is also present in bacteria isolated from human feces. The tet(W) genes found in human Fusobacterium prausnitzii and Bifidobacterium longum isolates were more than 99.9% identical to those from a rumen isolate of Butyrivibrio fibrisolvens.

Disease Class: Bartonella bacilliformis infection [1]

• Resistant Disease: Bartonella bacilliformis infection [ICD-11: 1C11.0]
• Resistant Drug: Tetracycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Bifidobacterium longum strain F10; 216816
• In Vitro Model: Bifidobacterium longum strain F5; 216816
• In Vitro Model: Bifidobacterium longum strain F8; 216816
• In Vitro Model: Butyrivibrio fibrisolvens strain 1.23; 831
• In Vitro Model: Butyrivibrio fibrisolvens strain 1.230; 831
• In Vitro Model: Butyrivibrio fibrisolvens strain Jk214; 831
• In Vitro Model: Butyrivibrio fibrisolvens strain Jk51; 831
• In Vitro Model: Fusobacterium prausnitzii strain k10; 853
• In Vitro Model: Mitsuokella multiacidus strain 46/5(2); 52226
• In Vitro Model: Mitsuokella multiacidus strain P208-58; 52226
• In Vitro Model: Selenomonas ruminantium strain FB32; 971
• In Vitro Model: Selenomonas ruminantium strain FB322; 971
• In Vitro Model: Selenomonas ruminantium strain FB34; 971
• Experiment for Molecule Alteration: Southern blotting assay
• Mechanism Description: Members of our group recently identified a new tetracycline resistance gene, tet(W), in three genera of rumen obligate anaerobes. Here, we show that tet(W) is also present in bacteria isolated from human feces. The tet(W) genes found in human Fusobacterium prausnitzii and Bifidobacterium longum isolates were more than 99.9% identical to those from a rumen isolate of Butyrivibrio fibrisolvens.

References

• Ref 1: Occurrence of the new tetracycline resistance gene tet(W) in bacteria from the human gut. Antimicrob Agents Chemother. 2000 Mar;44(3):775-7. doi: 10.1128/AAC.44.3.775-777.2000.