Molecule Information

General Information of the Molecule (ID: Mol01108)

• Name: Tetracycline resistance protein Tet (TETW/N/W) ,Escherichia coli
• Synonyms: tet(W; N; W); W/N/W
• Molecule Type: Protein
• Gene Name: tet(W N W)
• Sequence:
  MKIINIGILAHVDAGKTTLTESLLYASGAISEPGSVEKGTTRTDTMFLERQRGITIQAAV
  TSFQWHRCKVNIVDTPGHMDFLAEVYRSLAVLDGAILVISAKDGVQAQTRILFHALRKMN
  IPTVIFINKIDQAGVDLQSVYQSVRDKLSADIIIKQTVSLSPEIVLEENTDIEAWDAVIE
  NNDELLEKYIAGEPISREKLAREEQQRVQDASLFPVYHGSAKNGLGIQPLMDAVTGLFQP
  IGEQGGAALCGSVFKVEYTDCGQRLVYLRLYSGTLRLRDTVALAGREKLKITEMRIPSKG
  EIVRTDTAHKGEIVILPSDSLRLNDILGDKTQLPREMWSDVPFPMLRTTITPKTAEQRDR
  LLDALTQIADTDPLLHYEVDSITHEIILSFLGRVQLEVVSALLSEKYKLETVVKEPTVIY
  MERPLKAASHTIHIEVPPNPFWASIGLSVTPLPLGSGVQYESRVSLGYLNQSFQNAVRDG
  IRYGLEQGLFGWNVTDCKICFEYGLYYSPVSTPADFRSLAPIVLEQALKESGTQLLEPYL
  SFTLYAPREYLSRAYHDAPKYCATIETVQVKKDEVVFTGEIPARCIQAYRTDLAFYTNGR
  SVCLTELKGYQATVGEPIIQPRRPNSRLDKVRHMFSKIP
• Function: Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
• Uniprot ID: A0A142BVK9_9BACT

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 3 drug(s) in total

Chlortetracycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Chlortetracycline
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli EPI-300; 562
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Agar dilution method assay
• Mechanism Description: Tet(W/N/W) encodes mosaic ribosomal protection(since tetracyclines bind to the 30S ribosomal subunit to inhibit protein translation) and induces resistance.

Minocycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Minocycline
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli EPI-300; 562
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Agar dilution method assay
• Mechanism Description: Tet(W/N/W) encodes mosaic ribosomal protection(since tetracyclines bind to the 30S ribosomal subunit to inhibit protein translation) and induces resistance.

Tetracycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Bacterial infection [1]

• Resistant Disease: Bacterial infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Tetracycline
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli EPI-300; 562
• Experiment for Molecule Alteration: Whole genome sequence assay
• Experiment for Drug Resistance: Agar dilution method assay
• Mechanism Description: Tet(W/N/W) encodes mosaic ribosomal protection(since tetracyclines bind to the 30S ribosomal subunit to inhibit protein translation) and induces resistance.

References

• Ref 1: Diversity of the Tetracycline Mobilome within a Chinese Pig Manure Sample. Appl Environ Microbiol. 2016 Oct 14;82(21):6454-6462. doi: 10.1128/AEM.01754-16. Print 2016 Nov 1.