Molecule Information

General Information of the Molecule (ID: Mol01099)

Name	Tethering factor for nuclear proteasome STS1 (STS1) ,Saccharomyces cerevisiae
Synonyms	Dumbbell former protein 8; SEC23 suppressor 1; DBF8; SSM5; YIR011C; YIB11C Click to Show/Hide
Molecule Type	Protein
Gene Name	STS1
Gene ID	854828
Sequence	MMGFEWGFKPSSKITQSTVSSQGTGNVMIPTAGVKQKRRYANEEQEEEELPRNKNVMKYG GVSKRRPQPGSLIRGQPLPLQRGMELMNKNQLQQLLVDLMTKHPEIQQSVHTRVIGLDFS IQKCLDMLKQKSEAVYQSIPYNRSYESNKLDDYAFVRMKPQILEFLNCLVDFILDNIPPR LENLHASLKFLDICTELVIKLPRFELASNNYYYDKCIEQLSHVWCTLIEHVARDRIILLA DNSSVWKSHMTRLQVYNEHSNGLLERPLQLFKSLDMGSPSAASSSTLSLQESIIYHHDTM TANENNNNSGSAATDSPFN Click to Show/Hide
Function	Involved in ubiquitin-mediated protein degradation. Regulatory factor in the ubiquitin/proteasome pathway that controls the turnover of proteasome substrates. Targets proteasomes to the nucleus and facilitates the degradation of nuclear proteins. Required for efficient chromosome segregation. Restores protein transport and ribosomal RNA stability. Click to Show/Hide
Uniprot ID	STS1_YEAST
*Click to Show/Hide the Complete Species Lineage*
Kingdom: Fungi Phylum: Ascomycota Class: Saccharomycetes Order: Saccharomycetales Family: Saccharomycetaceae Genus: Saccharomyces Species: Saccharomyces cerevisiae

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

3 drug(s) in total

Click to Show/Hide the Full List of Drugs

Fluconazole

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)		Click to Show/Hide
Disease Class: Recurrent oropharyngeal candidiasis			[1]
Sensitive Disease	Recurrent oropharyngeal candidiasis [ICD-11: 1F23.6]		Disease Info
Sensitive Drug	Fluconazole		Drug Info
Molecule Alteration	Deletion mutation	Deleteion
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Saccharomyces cerevisiae strain		4932
Experiment for Molecule Alteration	qPCR; TEF3 probe assay
Experiment for Drug Resistance	Microbroth dilution MIC assay
Mechanism Description	The S. cerevisiae sts1 deletion mutant was hypersusceptible to all three azole derivatives used in the study, which is a strong indication that Sts1, a close homolog of Cdr1, is implicated in their transport.

Itraconazole

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)		Click to Show/Hide
Disease Class: Recurrent oropharyngeal candidiasis			[1]
Sensitive Disease	Recurrent oropharyngeal candidiasis [ICD-11: 1F23.6]		Disease Info
Sensitive Drug	Itraconazole		Drug Info
Molecule Alteration	Deletion mutation	Deleteion
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Saccharomyces cerevisiae strain		4932
Experiment for Molecule Alteration	qPCR; TEF3 probe assay
Experiment for Drug Resistance	Microbroth dilution MIC assay
Mechanism Description	The S. cerevisiae sts1 deletion mutant was hypersusceptible to all three azole derivatives used in the study, which is a strong indication that Sts1, a close homolog of Cdr1, is implicated in their transport.

Ketoconazole

Click to Show/Hide

Drug Sensitivity Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)		Click to Show/Hide
Disease Class: Recurrent oropharyngeal candidiasis			[1]
Sensitive Disease	Recurrent oropharyngeal candidiasis [ICD-11: 1F23.6]		Disease Info
Sensitive Drug	Ketoconazole		Drug Info
Molecule Alteration	Deletion mutation	Deleteion
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Saccharomyces cerevisiae strain		4932
Experiment for Molecule Alteration	qPCR; TEF3 probe assay
Experiment for Drug Resistance	Microbroth dilution MIC assay
Mechanism Description	The S. cerevisiae sts1 deletion mutant was hypersusceptible to all three azole derivatives used in the study, which is a strong indication that Sts1, a close homolog of Cdr1, is implicated in their transport.

References

Ref 1	Mechanisms of resistance to azole antifungal agents in Candida albicans isolates from AIDS patients involve specific multidrug transporters. Antimicrob Agents Chemother. 1995 Nov;39(11):2378-86. doi: 10.1128/AAC.39.11.2378.