Molecule Information

General Information of the Molecule (ID: Mol01093)

Name	Streptomycin aminoglycoside adenylyltransferase ant(6)-Ib (SA6IB) ,Campylobacter fetus subsp. Fetus
Synonyms	ant(6)-Ib; 6)-Ib Click to Show/Hide
Molecule Type	Protein
Gene Name	ant(6)-Ib
Sequence	MKMRTEKQIYDTILNFAKADDRIRVVTLEGSRTNINIIPDDFQDYDITFFVTDMQSFINS DEWLNVFGERLIMQKPEDMELFPKEEKGYSYLMLFWDGVKIDLTLLPLEVLDEYFTWDKL VKLLLDKDNRVTNIPVPTDEDYYIEHPTARSFDDCCNEFWNTVTYVVKGLCRKEILFAID HLNNIVRMELLRMISWKVGIEQGYSFSLGKNYKFLERYISPELWKKILATYNMGSYTEMW KSLELCMGIFRMVSKEVAQCLNYLYPDYDKNISNYVIRQKEKYQR Click to Show/Hide
Uniprot ID	D8L9Z0_CAMFE
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Epsilonproteobacteria Order: Campylobacterales Family: Campylobacteraceae Genus: Campylobacter Species: Campylobacter fetus subsp. fetus

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Streptomycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Campylobacter fetus infection			[1]
Resistant Disease	Campylobacter fetus infection [ICD-11: 1C40.0]		Disease Info
Resistant Drug	Streptomycin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli S17-1 Lambdapir		1227813
Experiment for Molecule Alteration	Illumina/Solexa sequencing assay
Experiment for Drug Resistance	Broth microdilution assay
Mechanism Description	The 286-amino-acid streptomycin resistance determinant, ANT(6)-Ib, belongs to a family of aminoglycoside nucleotidyltransferases. The resistance phenotypes were demonstrated by gene inactivation and expression.

References

Ref 1	Two novel antibiotic resistance genes, tet(44) and ant(6)-Ib, are located within a transferable pathogenicity island in Campylobacter fetus subsp. fetus. Antimicrob Agents Chemother. 2010 Jul;54(7):3052-5. doi: 10.1128/AAC.00304-10. Epub 2010 May 17.