Molecule Information

General Information of the Molecule (ID: Mol01058)
Name
Putative ABC transporter ATP-binding component (OTRC) ,Streptomyces rimosus
Synonyms
otrC; Putative ABC transporter ATP-binding component
    Click to Show/Hide
Molecule Type
Protein
Gene Name
otrC
Sequence
MTRKTISNGARNAVEVRGLVKHFGEVKAVDGVDLDVREGTVLGVLGPXGAAXXRGALPAH
VXGPDAGRRPWRFXTWCANRRALRRTIGXHRPVRXGRRESFSGRENLYMIGRXLDLSRKD
ARARADELLERFSLTEAAGRAAAKYSGGMRRRLDLAASMIGRPAVLYLDEPTTGLDPRTR
NEVWDEVRSMVRDGATVLLTTQYMEEAEQLAHELTVIDRGRVIADGKVDELKTKVGGRTL
QIRPAHAAELDRMVGAIAQAGLDGIAGATADHEDGVVNVPIVSDEQLSAVVGMLGERGFT
ISGHQHPSAQLXEVFLAITGQKTSEAADGGPQDGPQDQQGVQDKQYEEVPA
    Click to Show/Hide
Uniprot ID
Q6R7P5_STRRM
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces rimosus
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
5 drug(s) in total
Click to Show/Hide the Full List of Drugs
Ampicillin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ampicillin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli BL21 (DE3) 469008
Escherichia coli 668369
Escherichia coli ET12567 (pUZ8002) 562
Streptomyces rimosus M4018 1927
Streptomyces rimosus SR16 1927
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.
Doxorubicin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Doxorubicin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli BL21 (DE3) 469008
Escherichia coli 668369
Escherichia coli ET12567 (pUZ8002) 562
Streptomyces rimosus M4018 1927
Streptomyces rimosus SR16 1927
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.
Ofloxacin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Ofloxacin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli BL21 (DE3) 469008
Escherichia coli 668369
Escherichia coli ET12567 (pUZ8002) 562
Streptomyces rimosus M4018 1927
Streptomyces rimosus SR16 1927
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.
Oxytetracycline
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Oxytetracycline
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli BL21 (DE3) 469008
Escherichia coli 668369
Escherichia coli ET12567 (pUZ8002) 562
Streptomyces rimosus M4018 1927
Streptomyces rimosus SR16 1927
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.
Vancomycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Bacterial infection [1]
Resistant Disease Bacterial infection [ICD-11: 1A00-1C4Z]
 Disease Info 
Resistant Drug Vancomycin
 Drug Info 
Molecule Alteration Expression
Up-regulation
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli BL21 (DE3) 469008
Escherichia coli 668369
Escherichia coli ET12567 (pUZ8002) 562
Streptomyces rimosus M4018 1927
Streptomyces rimosus SR16 1927
Experiment for
Molecule Alteration		 Whole genome sequence assay; Allelic frequency measurement assay
Experiment for
Drug Resistance		 MIC assay
Mechanism Description OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.OtrC is a multidrug resistance protein based on an ATP hydrolysis-dependent active efflux mechanism.
References
Ref 1 Molecular cloning and functional characterization of an ATP-binding cassette transporter OtrC from Streptomyces rimosus. BMC Biotechnol. 2012 Aug 20;12:52. doi: 10.1186/1472-6750-12-52.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.