Molecule Information

General Information of the Molecule (ID: Mol01057)

• Name: Protein TetT (TETT) ,Streptococcus pyogenes
• Synonyms: tetT; TetT
• Molecule Type: Protein
• Gene Name: tetT
• Sequence:
  MKIINIGILAHVDAGKTTVTEGLLYKSGAINKIGRVDNATTTTDSMELERDRGITIRAST
  VSFNYNDTKVNIIDTPGHMDFIAEVERTLKVLDGAILVISAKEGIQVQTKVIFNTLVKLN
  IPTLIFVNKIDRKGVCLDEIYTQIQEKLTSNLAIMQSVKIKDKGDFELTNVRDDKVIQSQ
  IIEKLLDINDYLAEKYINGDVIAEKEYNDVFLDEINNCNLYPVFHGSALKNIGIDELLFA
  ITKYLPTKSYNTEDLLSAYVYKIDRDEKSRKMTFLRVFSGNIRTRQDVYINGTEETFKIK
  SLESIMNGEIVKVGQVNSGDIAIISNANSLKIGDYIGKKYDGILDIKIAQPALRASIKPC
  DLSKRSKLIEALFELTEEDPFLDCEINGDTGEIILRLFGNIQMEVIESLLKSRYKIDARF
  GELKTIYKERPKRNSKAVIHIEVPPNPYWASIGLSIEPLPIGSGLLYKTEVSYGYLNNSF
  QNAVKDAVEKACKEGLYGWEVTDLKVTFDYGLYYSPVSTPSDFRNLTPYVFWEALRKAGT
  EILEPYLKYTVQVPNDFCGRVMSDLRKMRASIEDIIAKGEETTLSGKIPVDTSKSYQSEL
  LSYSNGKGIFITEPYGYDIYNDKPIINDIGNDNNDSNKEGLRYLFQKQDEN
• Function: Abolishes the inhibitory effect of tetracyclin on protein synthesis by a non-covalent modification of the ribosomes.
• Uniprot ID: Q9RLW0_STRPY

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Streptococcaceae
Genus: Streptococcus
Species: Streptococcus pyogenes

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Minocycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Streptococcus pyogenes infection [1]

• Resistant Disease: Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Minocycline
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli strain TG1; 562
• In Vitro Model: Streptococcus agalactiae strain B130; 1311
• In Vitro Model: Streptococcus anginosus strain MG16; 1328
• In Vitro Model: Streptococcus anginosus strain MG23; 1328
• In Vitro Model: Streptococcus anginosus strain MG32; 1328
• In Vitro Model: Streptococcus bovis strain D135; 1335
• In Vitro Model: Streptococcus bovis strain D295; 1335
• In Vitro Model: Streptococcus equisimilis strain C94; 119602
• In Vitro Model: Streptococcus equisimilis strain C95; 119602
• In Vitro Model: Streptococcus equisimilis strain C96; 119602
• In Vitro Model: Streptococcus pyogenes strain A498; 1314
• In Vitro Model: Streptococcus sp. strain G59; 1306
• Experiment for Molecule Alteration: PCR
• Mechanism Description: The gene tet(T) was isolated from Streptococcus pyogenes A498, and the nucleotide sequence that was necessary and sufficient for the expression of tetracycline resistance in Escherichia coli was determined. The deduced Tet(T) protein consists of 651 amino acids. A phylogenetic analysis revealed that Tet T represents a novel branching order among the Tet determinants so far described.

Rifapentine

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Streptococcus pyogenes infection [1]

• Resistant Disease: Streptococcus pyogenes infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Rifapentine
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli strain TG1; 562
• In Vitro Model: Streptococcus agalactiae strain B130; 1311
• In Vitro Model: Streptococcus anginosus strain MG16; 1328
• In Vitro Model: Streptococcus anginosus strain MG23; 1328
• In Vitro Model: Streptococcus anginosus strain MG32; 1328
• In Vitro Model: Streptococcus bovis strain D135; 1335
• In Vitro Model: Streptococcus bovis strain D295; 1335
• In Vitro Model: Streptococcus equisimilis strain C94; 119602
• In Vitro Model: Streptococcus equisimilis strain C95; 119602
• In Vitro Model: Streptococcus equisimilis strain C96; 119602
• In Vitro Model: Streptococcus pyogenes strain A498; 1314
• In Vitro Model: Streptococcus sp. strain G59; 1306
• Experiment for Molecule Alteration: PCR
• Mechanism Description: The gene tet(T) was isolated from Streptococcus pyogenes A498, and the nucleotide sequence that was necessary and sufficient for the expression of tetracycline resistance in Escherichia coli was determined. The deduced Tet(T) protein consists of 651 amino acids. A phylogenetic analysis revealed that Tet T represents a novel branching order among the Tet determinants so far described.

References

• Ref 1: New tetracycline resistance determinants coding for ribosomal protection in streptococci and nucleotide sequence of tet(T) isolated from Streptococcus pyogenes A498. Antimicrob Agents Chemother. 1997 Jan;41(1):112-6. doi: 10.1128/AAC.41.1.112.