Molecule Information

General Information of the Molecule (ID: Mol01053)

Name	Probable dual-specificity RNA methyltransferase RlmN (RLMN ) ,Paenibacillus sp.
Synonyms	23S rRNA (adenine(2503)-C(2))-methyltransferase; 23S rRNA m2A2503 methyltransferase; Ribosomal RNA large subunit methyltransferase N; tRNA (adenine(37)-C(2))-methyltransferase; tRNA m2A37 methyltransferase; AK95_17035 Click to Show/Hide
Molecule Type	Protein
Gene Name	rlmN
Sequence	MKPFIYDYSLEELQAWAQENGEPAFRGTQIYDWLYVKRVNDFAEMTNLSKEFRTKLEQEF SFVTLTEITKLESKDGTVKFLFGLHDDHAIETVIMRHNYGNSICVTTQVGCRIGCTFCAS TLGGLKRNLTSGEIVAQVVQAQKILDKTGERVSSIVIMGSGEPFENYEATMKFLRTMIHE KGLNIGQRHITVSTSGIVPNIYKFTEEDTQINLAISIHAPNDKLRSKLMPVNRRFPFDDV IESLRYYQAKTGRRITFEYALIGGVNDQVEHAEELADVIKDMNCFVNLIPVNHVPERKYV RTSRNDIFKFQRALADKGVNVTIRREQGHDIAAACGQLRAKHMELR Click to Show/Hide
Function	Specifically methylates position 2 of adenine 2503 in 23S rRNA and position 2 of adenine 37 in tRNAs. Click to Show/Hide
Uniprot ID	A0A1S2EVL7_9BACL
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Bacilli Order: Bacillales Family: Paenibacillaceae Genus: Paenibacillus Species: Paenibacillus sp.

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Clindamycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Clindamycin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Paenibacillus sp. LC231		1120679
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	Broth microdilution method assay
Mechanism Description	A clindamycin resistance gene relates to the Rlmk 23S ribosomal RNA methyltransferase COG family.Clindamycin targets the peptidyltransferase centre and inhibits protein synthesis by interfering with transfer RNA binding at the A-site.

References

Ref 1	A diverse intrinsic antibiotic resistome from a cave bacterium. Nat Commun. 2016 Dec 8;7:13803. doi: 10.1038/ncomms13803.