Molecule Information

General Information of the Molecule (ID: Mol01050)

• Name: Polyamine transporter 1 (TPO1) ,Saccharomyces cerevisiae
• Synonyms: YLL028W; L0939
• Molecule Type: Protein
• Gene Name: TPO1
• Gene ID: 850631
• Sequence:
  MSDHSPISNKENHLLPSDSSRSSSSDMHSTGTTGTTGVEPVDFTGEGAKYTTATEGNGGA
  DLAIQRTTTMNSAAESEVNITRRLTKILTGSVNEPDRVEVDYTNCAPMGGDRPYPPSLPS
  RDLYEVTFDGPNDPLHPFNWPMKKKVLLCLVLCLDSIAIAMCSSIFASAVPQICEIYHVI
  EVVAILGITLFVLGFAASPVIYAPLSELYGRKGVLVLSAFGFALFQFAVATAENLQTIFI
  CRFFGGFIGAAPMAVVPAAFADMFDTNVRGKAIALFSLGVFVGPILSPVMGSYIAQRTTW
  RWLEYVVGCFASAVFVAIVLFFEETHHPTILVNKAKQMRKQSNNWGIHAAHEDVELSIKD
  IVQKTVTRPIIMLFVEPLLLFVTIYNSFVYGILYLLLEAYPLVFVEGYGFTENGELPYIA
  LIIGMMVCAAFIWYMDNDYLKRCRAKGKLVPEARLYAMVIAGTVFPIGILWFCWTGYYPH
  KIHWMVPTVGGAFIGFGLMGIFLPCLNYIIESYLLLAASAVAANTFMRSAFGACFPLFAG
  YMFRGMGIGWAGLLLGLFAAAMIPVPLLFLKYGESIRKKSKYAYAA
• Function: Cell membrane polyamine/proton antiporter, involved in the detoxification of excess polyamines in the cytoplasm. Catalyzes polyamine uptake at alkaline pH and excretion at acidic pH. Recognizes spermidine, spermine and putrescine, the polyamine analogs methylglyoxal bis(guanylhydrazone) (MGBG) and paraquat, the antimalarial drug quinidine, and cycloheximide. Confers resistance to the non-steroidal anti-inflammatory drug indomethacin.
• Uniprot ID: TPO1_YEAST

Kingdom: Fungi
Phylum: Ascomycota
Class: Saccharomycetes
Order: Saccharomycetales
Family: Saccharomycetaceae
Genus: Saccharomyces
Species: Saccharomyces cerevisiae

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Benzoic acid

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Fungal infection [1]

• Resistant Disease: Fungal infection [ICD-11: 1F29-1F2F]
• Resistant Drug: Benzoic acid
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Saccharomyces cerevisiae 23344c; 4932
• In Vitro Model: Saccharomyces cerevisiae BY4741; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_gcn4del; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_pdr1del; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_pdr3del; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_pdr8del; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_stp1del; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_stp2del; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_tpo1del; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_war1del; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_yap1del; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_yap2del; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_yap3del; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_yap4del; 1247190
• In Vitro Model: Saccharomyces cerevisiae BY4741_yap5del; 1247190
• Experiment for Molecule Alteration: RT-PCR
• Experiment for Drug Resistance: Benzoic acid susceptibility assay
• Mechanism Description: The Saccharomyces cerevisiae multidrug transporter Tpo1 was demonstrated to confer resistance to benzoic acid. TPO1 transcript levels were shown to be up-regulated in yeast cells suddenly exposed to this stress agent. This up-regulation is under the control of the Gcn4 and Stp1 transcription factors, involved in the response to amino acid availability, but not under the regulation of the multidrug resistance transcription factors Pdr1 and Pdr3 that have binding sites in TPO1 promoter.

References

• Ref 1: Yeast response and tolerance to benzoic acid involves the Gcn4- and Stp1-regulated multidrug/multixenobiotic resistance transporter Tpo1. Appl Microbiol Biotechnol. 2017 Jun;101(12):5005-5018. doi: 10.1007/s00253-017-8277-6. Epub 2017 Apr 13.