Molecule Information

General Information of the Molecule (ID: Mol01040)

Name	Peptide methionine sulfoxide reductase MsrB (MSRB) ,Escherichia coli
Synonyms	Peptide-methionine (R)-S-oxide reductase; yeaA; b1778; JW1767 Click to Show/Hide
Molecule Type	Protein
Gene Name	msrB
Gene ID	58462326
Sequence	MANKPSAEELKKNLSEMQFYVTQNHGTEPPFTGRLLHNKRDGVYHCLICDAPLFHSQTKY DSGCGWPSFYEPVSEESIRYIKDLSHGMQRIEIRCGNCDAHLGHVFPDGPQPTGERYCVN SASLRFTDGENGEEING Click to Show/Hide
Uniprot ID	MSRB_ECOLI
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Escherichia Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Triclosan

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)		Click to Show/Hide
Disease Class: Escherichia coli infection			[1]
Resistant Disease	Escherichia coli infection [ICD-11: 1A03.0]		Disease Info
Resistant Drug	Triclosan		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	E. coli IFN4		562
Experiment for Molecule Alteration	Microarray hybridization assay
Experiment for Drug Resistance	MIC assay
Mechanism Description	A FabI NAD+ triclosan ternary complex is formed by face-to-face interaction between the phenol ring of triclosan and the nicotinamide ring of NAD+ in the active site of FabI (enoyl-acyl carrier protein reductase) and therefore highly expressed reductases (narGHJI, garR, hcp and yeaA) and dehydrogenases (fdnGHI, ykgEF, garD, gldA and yeiQ) could bind triclosan which were as the NAD(P) cofactor, thus lowering the effective triclosan concentration.

References

Ref 1	Signature gene expression profile of triclosan-resistant Escherichia coli. J Antimicrob Chemother. 2010 Jun;65(6):1171-7. doi: 10.1093/jac/dkq114. Epub 2010 Apr 21.