Molecule Information

General Information of the Molecule (ID: Mol01032)

Name	Outer membrane protein U (OMPU) ,Vibrio cholerae
Synonyms	Porin OmpU; VC_0633 Click to Show/Hide
Molecule Type	Protein
Gene Name	ompU
Gene ID	57739348
Sequence	MNKTLIALAVSAAAVATGAYADGINQSGDKAGSTVYSAKGTSLEVGGRAEARLSLKDGKA QDNSRVRLNFLGKAEINDSLYGVGFYEGEFTTNDQGKNASNNSLDNRYTYAGIGGTYGEV TYGKNDGALGVITDFTDIMSYHGNTAAEKIAVADRVDNMLAYKGQFGDLGVKASYRFADR NAVDAMGNVVTETNAAKYSDNGEDGYSLSAIYTFGDTGFNVGAGYADQDDQNEYMLAASY RMENLYFAGLFTDGELAKDVDYTGYELAAGYKLGQAAFTATYNNAETAKETSADNFAIDA TYYFKPNFRSYISYQFNLLDSDKVGKVASEDELAIGLRYDF Click to Show/Hide
Function	Forms pores that allow passive diffusion of small molecules across the outer membrane. Click to Show/Hide
Uniprot ID	OMPU_VIBCH
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Vibrionales Family: Vibrionaceae Genus: Vibrio Species: Vibrio cholerae

Type(s) of Resistant Mechanism of This Molecule

IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Discontinued Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

BPI-derived peptide P2

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Vibrio cholerae infection			[1], [2]
Resistant Disease	Vibrio cholerae infection [ICD-11: 1A00.0]		Disease Info
Resistant Drug	BPI-derived peptide P2		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Vibrio cholerae N16961		243277
	Vibrio cholerae O395		345073
Experiment for Molecule Alteration	Whole genome sequence assay
Experiment for Drug Resistance	MIC assay
Mechanism Description	BPI and P2, a peptide that contains BPI residues 86 to 104, may employ the same mechanism for killing Escherichia coli since both increase outer membrane (OM) permeability to hydrophobic compounds and inhibit O2 consumption.The ompU mutant was more sensitive to P2 because it possessed a more fragile OM than did wt cells.

References

Ref 1	The Vibrio cholerae ToxR-regulated porin OmpU confers resistance to antimicrobial peptides. Infect Immun. 2004 Jun;72(6):3577-83. doi: 10.1128/IAI.72.6.3577-3583.2004.
Ref 2	OmpU as a biomarker for rapid discrimination between toxigenic and epidemic Vibrio cholerae O1/O139 and non-epidemic Vibrio cholerae in a modified MALDI-TOF MS assay. BMC Microbiol. 2014 Jun 18;14:158. doi: 10.1186/1471-2180-14-158.