Molecule Information

General Information of the Molecule (ID: Mol01022)

Name	NADH-dependent enoyl-ACP reductase (FABL) ,Escherichia coli
Synonyms	ENR; NADH-dependent enoyl-ACP reductase; envM; b1288; JW1281 Click to Show/Hide
Molecule Type	Protein
Gene Name	fabI
Gene ID	67417387
Sequence	MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI SGEVVHVDGGFSIAAMNELELK Click to Show/Hide
Function	Catalyzes the reduction of a carbon-carbon double bond in an enoyl moiety that is covalently linked to an acyl carrier protein (ACP). Involved in the elongation cycle of fatty acid which are used in the lipid metabolism and in the biotin biosynthesis. Click to Show/Hide
Uniprot ID	FABI_ECOLI
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Escherichia Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Triclosan

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Escherichia coli infection			[1]
Resistant Disease	Escherichia coli infection [ICD-11: 1A03.0]		Disease Info
Resistant Drug	Triclosan		Drug Info
Molecule Alteration	Missense mutation	p.G93V
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	E. coli IFN4		562
	E. coli imp4231 FabI(G93V) strain		562
Experiment for Drug Resistance	MIC assay
Mechanism Description	Among the triclosan-resistant mutants, E. coli AGT11, which had a Gly93 Val mutation in fabI, FabI(G93V), showed a 95-fold higher MIC than the wild-type. On the basis of these results, Levy et al.7 carried out structural analysis and inhibition experiments on a complex of E. coli FabI with triclosan and NAD+ and found that a FabI NAD+ triclosan ternary complex was formed by face-to-face interaction between the phenol ring of triclosan and the nicotinamide ring of NAD+ in the active site of FabI. In contrast to intact FabI, overexpression of FabI(G93V) conferred greater triclosan resistance by preventing formation of the FabI NAD+ triclosan ternary complex.

References

Ref 1	Signature gene expression profile of triclosan-resistant Escherichia coli. J Antimicrob Chemother. 2010 Jun;65(6):1171-7. doi: 10.1093/jac/dkq114. Epub 2010 Apr 21.