Molecule Information

General Information of the Molecule (ID: Mol01021)

Name	NAD-dependent protein deacylase Sir2 (SIR2) ,Mycolicibacterium smegmatis
Synonyms	Regulatory protein SIR2 homolog; cobB; npdA; MSMEG_5175; MSMEI_5041 Click to Show/Hide
Molecule Type	Protein
Gene Name	sir2
Gene ID	66736490
Sequence	MQVTVLSGAGISAESGVPTFRDAETGLWAQVDPYEISSTDGWQRNPEKVWAWYLWRHYMM ARVAPNEAHRTVAAWEDHLDVRVVTQNIDDLHERAGSTNVYHLHGSLFEFRCDACGSAFE GNLPEMPEPVETIDPPVCPCSGLIRPSVVWFGEPLPDAAWNRSVLAVSSADVVIVVGTSS IVYPAAGLPEAALAAGKPVIEVNPERTPLSDSATVSLRETASEALPTLLQRLPELLNRSA Click to Show/Hide
Function	NAD-dependent lysine deacetylase and desuccinylase that specifically removes acetyl and succinyl groups on target proteins. Modulates the activities of several proteins which are inactive in their acylated form. Click to Show/Hide
Uniprot ID	NDP_MYCS2
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Actinobacteria Class: Actinomycetia Order: Corynebacteriales Family: Mycobacteriaceae Genus: Mycolicibacterium Species: Mycolicibacterium smegmatis

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Isoniazid

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)		Click to Show/Hide
Disease Class: Mycolicibacterium smegmatis infection			[1]
Resistant Disease	Mycolicibacterium smegmatis infection [ICD-11: 1B2Z.6]		Disease Info
Resistant Drug	Isoniazid		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli		668369
	Mycobacterium smegmatis mc2155		246196
Experiment for Molecule Alteration	Quantitative Real-Time PCR
Experiment for Drug Resistance	Colony forming units determination assay
Mechanism Description	MSMEG_5175 regulates diverse cellular processes resulting in an increase in INH resistance in mycobacteria. Overexpression of MSMEG_5175 results in up-regulation of 34 proteins and down-regulation of 72 proteins, which involve in diverse cellular processes including metabolic activation, transcription and translation, antioxidant, and DNA repair. Down-regulation of catalase peroxidase (katG) expression in both mRNA and protein levels were observed in mc(2)155-MS5175 strain, suggesting that a decrease in cellular NAD content and down-regulation of katG expression contribute to the higher resistance to INH in mc(2)155-MS5175.

References

Ref 1	Functional Characterization of Sirtuin-like Protein in Mycobacterium smegmatis. J Proteome Res. 2015 Nov 6;14(11):4441-9. doi: 10.1021/acs.jproteome.5b00359. Epub 2015 Sep 29.