Molecule Information
General Information of the Molecule (ID: Mol01009)
Name |
Multidrug efflux pump Tap (TAP)
,Mycobacterium fortuitum
|
||||
---|---|---|---|---|---|
Synonyms |
Tetracycline-aminoglycoside resistance protein
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
tap
|
||||
Sequence |
MTNTKRGPLLLILFAALTAGAGNGITIVAFPWLVLQHNGSALDASIVAMAGTLPLLVATL
IAGAAVDYLGRRRVSMISDLLSALSVAAVPVLALIFGVDAVNVAVLAVLAGLGAFFDPAG MTARETMLPEAAGRAGWTLDHANSVYEAVFNLGYIVGPGIGGLMIATLGGINTMWVTAGA FCCSILAISVLRLEGAGAPDRSVLTEAVLAGIVEGLRFVWYTPVLRTLAIVDLVATGLYM PMESVLFPKYFTDRNEPTELGWVLMALSIGGLLGALGYAVMSRYMSRRATMLTAVITLGV AMTVIAFLPPLPLILVLCAIVGFVYGPIAPIYNYVMQTTAPQHLRGRVVGVMGSLAYAAG PLGLILAGPLADAAGLHATFLALSLPMLLLGVVAVFLPRLRELDLASKP Click to Show/Hide
|
||||
Function |
Efflux pump that contributes to intrinsic antibiotic resistance. The pump uses the electrochemical gradient as a source of energy. Confers low-level resistance to tetracycline and to several aminoglycosides, including streptomycin, gentamicin, 2'-N-ethylnetilmicin and 6'-N-ethylnetilmicin.
Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Approved Drug(s)
2 drug(s) in total
Ofloxacin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Bacterial infection | [1], [2] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Ofloxacin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium tuberculosis H37Rv | 83332 | ||
Mycobacterium tuberculosis ICC154 | 1773 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | One mechanism proposed for drug resistance in Mycobacterium tuberculosis (MTB) is by efflux of the drugs by membrane located pumps.Mycobacterium tuberculosis isolate with a distinct genomic identity overexpresses a tap-like efflux pump,which confers resistance to Rifampin and Ofloxacin. | |||
Disease Class: Bacterial infection | [1], [2] | |||
Resistant Disease | Bacterial infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Ofloxacin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium tuberculosis H37Rv | 83332 | ||
Mycobacterium tuberculosis ICC154 | 1773 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | One mechanism proposed for drug resistance in Mycobacterium tuberculosis (MTB) is by efflux of the drugs by membrane located pumps.Mycobacterium tuberculosis isolate with a distinct genomic identity overexpresses a tap-like efflux pump,which confers resistance to Rifampin and Ofloxacin. |
Rifampin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Irregularity in Drug Uptake and Drug Efflux (IDUE) | ||||
Disease Class: Mycobacterium fortuitum infection | [1], [2] | |||
Resistant Disease | Mycobacterium fortuitum infection [ICD-11: 1B2Z.2] | |||
Resistant Drug | Rifampin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Mycobacterium tuberculosis H37Rv | 83332 | ||
Mycobacterium tuberculosis ICC154 | 1773 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay | |||
Experiment for Drug Resistance |
MIC assay | |||
Mechanism Description | One mechanism proposed for drug resistance in Mycobacterium tuberculosis (MTB) is by efflux of the drugs by membrane located pumps.Mycobacterium tuberculosis isolate with a distinct genomic identity overexpresses a tap-like efflux pump,which confers resistance to Rifampin and Ofloxacin. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.