Molecule Information

General Information of the Molecule (ID: Mol01005)

• Name: MipA/OmpV family protein (MIPA) ,Escherichia coli
• Synonyms: mipA_1; mipA_2; mipA_3; yeaF; A5U30_001087; A6592_19280; A9819_10670; A9X72_11000; AAG43_000520; ABE90_019965; ACN68_30755; ACN81_10320; ACU57_21615; AM464_26860; APX88_07455; AT845_004658; AW119_12300; AWP93_05925; B6R12_000119; B6R15_000724; B6R31_000233; B6R48_000233; B6R87_000233; BANRA_00248; BANRA_02413; BANRA_02785; BEA19_00875; BF481_000201; BG944_000108; BGZ_01850; BGZ_04388; BHS81_10900; BJI68_17765; BJJ90_14135; BK292_17855; BK383_05390; BMC79_000208; BMT91_18675; BN17_20341; BO068_000018; BOH76_18525; BON63_18125; BON64_22695; BON65_17125; BON66_05905; BON67_18175; BON68_11835; BON70_09730; BON72_27325; BON73_24705; BON74_09895; BON75_13735; BON76_12715; BON77_00925; BON78_12405; BON79_02590; BON80_17505; BON81_01555; BON82_17640; BON83_03860; BON84_24135; BON86_05465; BON87_10815; BON88_03920; BON89_13755; BON90_23850; BON92_13405; BON93_06700; BON94_09770; BON97_12265; BON98_10820; BR158_000390; BTQ06_05315; BvCmsHHP019_05150; BvCmsHHP056_00783; BvCmsKKP036_02059; BvCmsKKP061_04318; BvCmsKSNP073_04520; BvCmsNSP072_02645; BVL39_18970; BXT93_26455; BZL69_19880; C2U48_25900; C3F40_01785; C5N07_01375; C5Y87_05760; C9114_21155; C9160_06050; CA593_19005; CCS08_13955; CCV12_001127; CDC27_09075; CDL36_03065; CDL37_01750; CG692_10065; CG831_002652; CIG67_17150; CO706_05910; CQP61_15935; CR538_11410; CR539_13625; CV83915_04606; CWS33_04795; CXJ73_001049; CY655_11640; D0X26_03230; D1912_31520; D3822_16970; D3C88_29230; D3Y67_22495; D4U49_20170; D9D43_13130; D9D77_22010; D9E34_10800; D9E49_08925; D9J03_05965; DAH17_07560; DAH18_10360; DAH19_08855; DAH20_04095; DAH21_07505; DAH22_12500; DAH27_01220; DAH28_01210; DAH29_00080; DAH30_07025; DAH31_01035; DAH32_01135; DAH33_04575; DAH34_16310; DAH35_04805; DAH36_19115; DAH37_24700; DAH38_17595; DAH40_08950; DAH41_20760; DAH50_23660; DD762_04530; DEN88_11730; DEN89_00890; DEN90_03755; DEN91_17655; DEN92_16575; DEN93_23480; DEN94_04560; DEN95_04520; DEN96_20770; DEN97_21495; DEN98_21765; DEN99_20435; DEO00_21620; DEO01_07425; DEO02_06260; DEO03_18890; DEO12_03005; DEO13_22720; DEO14_17790; DEO15_23745; DEO17_04080; DEO18_07100; DEO19_20950; DEO20_15390; DIV22_02445; DKP82_08850; DM870_14120; DN627_08305; DNQ45_10645; DNX30_01015; DS732_14650; DTL43_17030; DTL90_13380; DTM45_01380; DU321_20785; DXT70_10330; DXT71_10240; DXT73_03825; E0I42_10385; E2112_21315; E2113_12135; E2114_02795; E2115_01280; E2116_00405; E2117_01915; E2118_09800; E2119_18115; E2120_00405; E2121_05085; E2122_02585; E2123_01280; E2124_00405; E2125_00410; E2127_17410; E2128_16240; E2129_01565; E2130_00405; E2131_22975; E2132_17510; E2133_07780; E2134_06170; E2135_23210; E2136_09150; E4K51_20550; E4T14_20665; E5M02_18790; E5P23_21885; E5P24_15030; E5P25_06535; E5P26_00270; E5P27_10215; E5P28_09830; E5P29_01440; E5P30_01535; E5P31_01075; E5P32_07755; E5P33_16540; E5P34_00455; E5P35_16660; E5P36_07830; E5P37_03840; E5P39_04740; E5P40_09010; E5P41_19785; E5P42_10050; E5P43_12600; E5P44_07170; E5P45_06465; E5P46_10550; E5P47_03870; E5P48_14915; E5P49_15255; E5P50_05070; E5P51_13535; E5P52_15985; E5S35_02185; E5S36_01405; E5S38_04890; E5S39_02855; E5S42_05035; E5S43_04650; E5S44_06300; E5S45_12235; E5S46_05700; E5S47_09260; E5S48_20785; E5S51_04835; E5S52_08340; E5S53_18095; E5S55_18050; E5S56_07435; E5S57_03130; E5S58_15820; E5S59_07760; E5S61_03300; E5S62_02555; EA239_04225; EA435_04855; EAI46_10775; EAN77_01895; EAX79_00500; EBP16_08855; EC1094V2_1964; EC3234A_34c00210; EC95NR1_00683; ECs2491; ED648_14425; EHD79_01390; EHH55_08210; EI021_02395; EIZ93_02525; EKI52_27530; EL79_1912; EL80_1940; ELT16_00395; ELT17_11725; ELT20_00680; ELT21_16320; ELT22_01055; ELT24_13955; ELT25_01390; ELT26_11155; ELT27_01960; ELT28_00405; ELT29_01145; ELT30_05295; ELT32_05345; ELT34_05275; ELT35_03060; ELT36_05180; ELT39_02155; ELT40_01420; ELT41_00205; ELT44_08970; ELT45_01865; ELT46_07605; ELT48_10215; ELT49_11110; ELT51_03250; ELT54_02550; ELT55_12615; ELT58_10860; ELT59_05945; ELT60_04415; ELT61_05525; ELT63_13305; ELT72_01705; ELU07_10225; ELU82_08805; ELU83_05645; ELU85_03750; ELU88_03450; ELU89_06625; ELU90_11950; ELU91_07965; ELU94_01225; ELU96_08980; ELU97_03920; ELU98_06740; ELU99_01170; ELV00_06275; ELV01_04475; ELV02_02865; ELV03_03405; ELV04_02295; ELV07_05155; ELV08_22915; ELV09_07175; ELV11_11190; ELV12_04140; ELV13_11495; ELV15_07405; ELV20_21155; ELV21_00265; ELV22_13320; ELV23_06795; ELV24_02430; ELV26_01405; ELV28_00495; ELV29_12935; ELV40_15430; ELX48_02330; ELX56_10545; ELX61_04860; ELX66_00810; ELX68_19715; ELX69_00270; ELX70_00395; ELX76_02960; ELX79_11870; ELX83_09060; ELX85_12885; ELX96_10290; ELY02_04610; ELY05_11780; ELY23_02700; ELY24_09835; ELY31_17470; ELY32_03450; ELY36_02750; ELY39_12015; ELY41_20605; ELY48_20330; ELY50_01015; EPS76_02565; ERS085406_02775; ERS139208_01473; EVY14_10430; ExPECSC038_01753; EXX13_10875; EYV17_15025; EYV18_17220; EYY21_12545; F0L67_07650; F3N40_10230; F9B07_11780; F9S76_09035; F9S83_08110; F9V24_14235; F9X20_18375; FDM60_15565; FFF58_01930; FGG80_00885; FJQ51_02060; FOI11_004140; FOI11_15905; FQ007_03560; FQF29_19030; FV293_05490; FVB16_09965; G3565_11945; G3813_000283; G4A38_01055; G5632_20760; G9448_01750; GAJ26_03765; GF147_00790; GFY34_02530; GIB53_19600; GJ11_12285; GKF86_06995; GKF89_04675; GKG12_15995; GNO40_00255; GNZ05_10870; GP650_05650; GP662_11670; GP711_12185; GP946_06540; GP954_08545; GQA06_15410; GQE64_05925; GQM04_05750; GQM13_04660; GQW07_06150; GQW68_03295; GRC73_09935; GRO95_04335; GRW05_22845; GRW81_12545; GSY44_08620; GUB08_07250; GUB92_03005; GUC01_03955; GUI33_14005; H0O72_06675; H6Y26_000340; HIE29_000876; HJQ60_004801; HJS37_000399; HJU54_003159; HKA49_000193; HL563_01180; HLV18_03785; HLZ50_03035; HmCms169_02729; HMU48_00925; HNC36_15455; HNC59_03960; HNC66_03480; HNC99_00395; HV109_10045; HV209_08430; HVV39_26355; HVW19_04095; HVW43_02080; HVX16_10955; HVY77_11510; HVZ71_10880; HX136_14110; I6H02_02355; IA00_002138; IAI11_20995; IFB95_001680; IH768_04980; IH772_05395; IT029_000050; J0541_000433; J5U05_000369; JE86ST02C_21670; JE86ST05C_22620; JFD_03966; JNP96_15500; NCTC10082_04742; NCTC10429_03374; NCTC10764_01742; NCTC10958_02403; NCTC10974_02532; NCTC11112_06110; NCTC11126_04677; NCTC11181_05270; NCTC11341_05830; NCTC13216_04479; NCTC7922_02489; NCTC7928_06355; NCTC8008_01671; NCTC8179_03916; NCTC8333_02706; NCTC8450_02594; NCTC8500_02483; NCTC8622_04882; NCTC8960_05001; NCTC8985_00802; NCTC9036_02341; NCTC9037_02382; NCTC9044_04949; NCTC9045_02650; NCTC9073_05799; NCTC9111_02336; NCTC9117_02870; NCTC9706_04050; NCTC9775_01021; NCTC9777_04437; ND22_000191; PGD_01451; RG28_13160; SAMEA3472044_01276; SAMEA3472056_01450; SAMEA3472067_01703; SAMEA3472080_04939; SAMEA3472147_03511; SAMEA3751407_03241; SAMEA3752557_04195; SAMEA3753106_04897; TUM18780_19170; WP2S18E08_21310; WP4S18E07_20330; WR15_13500
• Molecule Type: Protein
• Gene Name: mipA
• Gene ID: 58391373
• Sequence:
  MTKLKLLALGVLIATSAGVAHAEGKFSLGAGVGVVEHPYKDYDTDVYPVPVINYEGDNFW
  FRGLGGGYYLWNDATDKLSITAYWSPLYFKAKDSGDHQMRHLDDRKSTMMAGLSYAHFTQ
  YGYLRTTLAGDTLDNSNGIVWDMAWLYRYTNGGLTVTPGIGVQWNSENQNEYYYGVSRKE
  SARSGLRGYNPNDSWSPYLELSASYNFLGDWSVYGTARYTRLSDEVTDSPMVDKSWTGLI
  STGITYKF
• Uniprot ID: C3T6U7_ECOLX

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 5 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Gram-negative bacterial infection [1]

• Resistant Disease: Gram-negative bacterial infection [ICD-11: 1B74-1G40]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli k-12 BW25113; 679895
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: OM proteins, a unique OM component of Gram-negative bacteria, constitute a barrier against large hydrophilic and lipophilic molecules and therefore play an important role in stress responses to drugs, osmotic pressure and acids.MipA is a novel OM protein related to antibiotic resistance.

Chlortetracycline

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Gram-negative bacterial infection [1]

• Resistant Disease: Gram-negative bacterial infection [ICD-11: 1B74-1G40]
• Resistant Drug: Chlortetracycline
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli k-12 BW25113; 679895
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: OM proteins, a unique OM component of Gram-negative bacteria, constitute a barrier against large hydrophilic and lipophilic molecules and therefore play an important role in stress responses to drugs, osmotic pressure and acids.MipA is a novel OM protein related to antibiotic resistance.

Kanamycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Gram-negative bacterial infection [1]

• Resistant Disease: Gram-negative bacterial infection [ICD-11: 1B74-1G40]
• Resistant Drug: Kanamycin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli k-12 BW25113; 679895
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: OM proteins, a unique OM component of Gram-negative bacteria, constitute a barrier against large hydrophilic and lipophilic molecules and therefore play an important role in stress responses to drugs, osmotic pressure and acids.MipA is a novel OM protein related to antibiotic resistance.

Nalidixic acid

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Gram-negative bacterial infection [1]

• Resistant Disease: Gram-negative bacterial infection [ICD-11: 1B74-1G40]
• Resistant Drug: Nalidixic acid
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli k-12 BW25113; 679895
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: OM proteins, a unique OM component of Gram-negative bacteria, constitute a barrier against large hydrophilic and lipophilic molecules and therefore play an important role in stress responses to drugs, osmotic pressure and acids.MipA is a novel OM protein related to antibiotic resistance.MipA expression was up-regulated in kanamycin-resistant,Au-R and Cm-R strains and down-regulated in NA-R and Str-R strains.

Streptomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Gram-negative bacterial infection [1]

• Resistant Disease: Gram-negative bacterial infection [ICD-11: 1B74-1G40]
• Resistant Drug: Streptomycin
• Molecule Alteration: Expression; Down-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli k-12 BW25113; 679895
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: OM proteins, a unique OM component of Gram-negative bacteria, constitute a barrier against large hydrophilic and lipophilic molecules and therefore play an important role in stress responses to drugs, osmotic pressure and acids.MipA is a novel OM protein related to antibiotic resistance.

References

• Ref 1: Outer membrane proteomics of kanamycin-resistant Escherichia coli identified MipA as a novel antibiotic resistance-related protein. FEMS Microbiol Lett. 2015 Jun;362(11):fnv074. doi: 10.1093/femsle/fnv074. Epub 2015 May 3.