Molecule Information

General Information of the Molecule (ID: Mol01001)

Name	Metallo beta lactamase (TMB1) ,Achromobacter xylosoxidans
Synonyms	tmb-1; Metallo beta lactamase Click to Show/Hide
Molecule Type	Protein
Gene Name	tmb-1
Sequence	MRPFLFLIIFISHFAFANEEIPGLEVEEIDNGVFLHKSYSRVEGWGLVSSNGLVVISGGK AFIIDTPWSESDTEKLVDWIRSKKYELAGSISTHSHEDKTAGIKWLNGKSITTYASALTN EILKREGKEQARSSFKGNEFSLMDGFLEVYYPGGGHTIDNLVVWIPSSKILYGGCFIRSL ESSGLGYTGEAKIDQWPQSARNTISKYPEAKIVVPGHGKIGDFELLKHTKVLAEKASNKA NHGDR Click to Show/Hide
Uniprot ID	E7BCS5_9BURK
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Betaproteobacteria Order: Burkholderiales Family: Alcaligenaceae Genus: Achromobacter Species: Achromobacter xylosoxidans

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Ceftazidime

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Bacterial infection			[1]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Ceftazidime		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli TOP10		83333
	Achromobacter xylosoxidans AES301		85698
	Escherichia coli J53		1144303
Experiment for Molecule Alteration	Whole genome sequence assay; Allelic frequency measurement assay
Experiment for Drug Resistance	Etest assay
Mechanism Description	These enzymes very efficiently hydrolyze all Beta-lactams, including carbapenems (with the exception of aztreonam), and the Beta-lactamase genes most often are located on transferable genetic platforms, namely, either ISCR elements or class 1 integrons sometimes embedded in Tn21- or Tn402-like transposons.A novel MBL, TMB-1 (for Tripoli metallo-Beta-lactamase) can inactivate the antibiotics.

References

Ref 1	Genetic and biochemical characterization of a novel metallo-Beta-lactamase, TMB-1, from an Achromobacter xylosoxidans strain isolated in Tripoli, Libya. Antimicrob Agents Chemother. 2012 May;56(5):2241-5. doi: 10.1128/AAC.05640-11. Epub 2012 Jan 30.