Molecule Information

General Information of the Molecule (ID: Mol00994)

Name	Macrolide-lincosamide-streptogramin B resistance protein (ERMQ) ,Clostridium perfringens
Synonyms	rRNA adenine N-6-methyltransferase Click to Show/Hide
Molecule Type	Protein
Gene Name	ermQ
Sequence	MKAKSNNYRGKVDISVSQNFITSKNTIYKLIKKTNISKNDFVIEIGPGKGHITEALCEKS YWVTAIELDRSLYGNLINKFKSKNNVTLINKDFLNWKLPKKREYKVFSNIPFYITTKIIK KLLLEELNSPTDMWLVMEKGSAKRFMGIPRESKLSLLLKTKFDIKIVHYFNREDFHPMPS VDCVLVYFKRKYKYDISKDEWNEYTSFISKSINNLRDVFTKNQIHAVIKYLGINLNNISE VSYNDWIQLFRYKQKID Click to Show/Hide
Uniprot ID	Q46194_CLOPF
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Clostridia Order: Eubacteriales Family: Clostridiaceae Genus: Clostridium Species: Clostridium perfringens

Type(s) of Resistant Mechanism of This Molecule

ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Erythromycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Aberration of the Drug's Therapeutic Target (ADTT)		Click to Show/Hide
Disease Class: Clostridium perfringens infection			[1]
Resistant Disease	Clostridium perfringens infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Erythromycin		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli DH5alpha		668369
	Clostridium perfringens isolates		1502
	Escherichia coli strain JM105		83333
	Three MLS-resistant isolates of Clostridium difficile		1496
Experiment for Molecule Alteration	Pharmacia T7 Sequencing kits assay
Mechanism Description	Erythromycin resistance among streptococci is commonly due to target site modification by an rRNA-methylating enzyme, which results in coresistance to macrolide, lincosamide, and streptogramin B antibiotics (MLSB resistance). An open reading frame with sequence similarity to erm genes from other bacteria was identified and designated the ermQ gene. On the basis of comparative sequence analysis, it was concluded that the ermQ gene represented a new Erm hybridization class, designated ErmQ. The ermQ gene therefore represents the most common erythromycin resistance determinant in C. perfringens.

References

Ref 1	Cloning and sequence analysis of ermQ, the predominant macrolide-lincosamide-streptogramin B resistance gene in Clostridium perfringens. Antimicrob Agents Chemother. 1994 May;38(5):1041-6. doi: 10.1128/AAC.38.5.1041.