Molecule Information

General Information of the Molecule (ID: Mol00975)

Name	Heat-shock protein IbpA (IBPA) ,Pseudomonas aeruginosa
Synonyms	ibpA; PA3126; Heat-shock protein IbpA Click to Show/Hide
Molecule Type	Protein
Gene Name	ibpA
Gene ID	882640
Sequence	MSNAFSLAPLFRHSVGFDRFNDLFESALRNEAGSTYPPYNVEKHGDDEYRIVIAAAGFQE EDLDLQVERGVLTVSGGKREKSTDNVTYLHQGIAQRAFKLSFRLADHIEVKAASLANGLL NIDLVRLVPEEAKPKRIAINGQRPALDNQ Click to Show/Hide
Uniprot ID	Q9HZ98_PSEAE
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Pseudomonadales Family: Pseudomonadaceae Genus: Pseudomonas Species: Pseudomonas aeruginosa

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Tobramycin

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)		Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection			[1]
Resistant Disease	Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Tobramycin		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Pseudomonas aeruginosa MPAO1		1131757
Experiment for Molecule Alteration	SRM analysis
Experiment for Drug Resistance	MIC assay
Mechanism Description	The extracellular polysaccharide layer of biofilm can prolong the time of bactericide penetration into the central cell cluster. The proteomic response of Pseudomonas aeruginosa depends on the level of tobramycin experienced by the cells after exposure to various sub inhibitory levels (0.1-1) u Tobramycin (g / ml) can induce different proteins. Bacterial cells exposed to low levels of tobramycin showed elevated levels of enzymes that metabolize and synthesize amino acids that may alter drug sensitivity. Inactivation of ibpA did not yield significant tobramycin MIC changes. However, inactivation of two heat shock proteins/proteases ibpA/clpB, ibpA/PA0779, or ibpA/hslV led to increased tobramycin sensitivity changes in P. aeruginosa.

References

Ref 1	Dynamic Proteome Response of Pseudomonas aeruginosa to Tobramycin Antibiotic Treatment. Mol Cell Proteomics. 2015 Aug;14(8):2126-37. doi: 10.1074/mcp.M115.050161. Epub 2015 May 27.