Molecule Information

General Information of the Molecule (ID: Mol00963)

Name	FDH-N subunit gamma (FDHNI) ,Escherichia coli
Synonyms	Anaerobic formate dehydrogenase cytochrome b556 subunit; Formate dehydrogenase-N subunit gamma; FDH-N subunit gamma; b1476; JW1472 Click to Show/Hide
Molecule Type	Protein
Gene Name	fdnI
Gene ID	66674672
Sequence	MSKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFF GIAIFVALMFMFVRFVHHNIPDKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFWSI MSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGIILIHAILIHMYMAFWVKGSI KGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI Click to Show/Hide
Function	Formate dehydrogenase allows E.coli to use formate as major electron donor during anaerobic respiration, when nitrate is used as electron acceptor. Subunit gamma is the cytochrome b556 component of the formate dehydrogenase-N, and also contains a menaquinone reduction site that receives electrons from the beta subunit (FdnH), through its hemes. Formate dehydrogenase-N is part of a system that generates proton motive force, together with the dissimilatory nitrate reductase (Nar). Click to Show/Hide
Uniprot ID	FDNI_ECOLI
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Enterobacterales Family: Enterobacteriaceae Genus: Escherichia Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Triclosan

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Unusual Activation of Pro-survival Pathway (UAPP)		Click to Show/Hide
Disease Class: Escherichia coli infection			[1]
Resistant Disease	Escherichia coli infection [ICD-11: 1A03.0]		Disease Info
Resistant Drug	Triclosan		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	E. coli IFN4		562
Experiment for Molecule Alteration	Microarray hybridization assay
Experiment for Drug Resistance	MIC assay
Mechanism Description	A FabI NAD+ triclosan ternary complex is formed by face-to-face interaction between the phenol ring of triclosan and the nicotinamide ring of NAD+ in the active site of FabI (enoyl-acyl carrier protein reductase) and therefore highly expressed reductases (narGHJI, garR, hcp and yeaA) and dehydrogenases (fdnGHI, ykgEF, garD, gldA and yeiQ) could bind triclosan which were as the NAD(P) cofactor, thus lowering the effective triclosan concentration.

References

Ref 1	Signature gene expression profile of triclosan-resistant Escherichia coli. J Antimicrob Chemother. 2010 Jun;65(6):1171-7. doi: 10.1093/jac/dkq114. Epub 2010 Apr 21.