General Information of the Molecule (ID: Mol00963)
Name
FDH-N subunit gamma (FDHNI) ,Escherichia coli
Synonyms
Anaerobic formate dehydrogenase cytochrome b556 subunit; Formate dehydrogenase-N subunit gamma; FDH-N subunit gamma; b1476; JW1472
    Click to Show/Hide
Molecule Type
Protein
Gene Name
fdnI
Gene ID
66674672
Sequence
MSKSKMIVRTKFIDRACHWTVVICFFLVALSGISFFFPTLQWLTQTFGTPQMGRILHPFF
GIAIFVALMFMFVRFVHHNIPDKKDIPWLLNIVEVLKGNEHKVADVGKYNAGQKMMFWSI
MSMIFVLLVTGVIIWRPYFAQYFPMQVVRYSLLIHAAAGIILIHAILIHMYMAFWVKGSI
KGMIEGKVSRRWAKKHHPRWYREIEKAEAKKESEEGI
    Click to Show/Hide
Function
Formate dehydrogenase allows E.coli to use formate as major electron donor during anaerobic respiration, when nitrate is used as electron acceptor. Subunit gamma is the cytochrome b556 component of the formate dehydrogenase-N, and also contains a menaquinone reduction site that receives electrons from the beta subunit (FdnH), through its hemes. Formate dehydrogenase-N is part of a system that generates proton motive force, together with the dissimilatory nitrate reductase (Nar).
    Click to Show/Hide
Uniprot ID
FDNI_ECOLI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli
Type(s) of Resistant Mechanism of This Molecule
  UAPP: Unusual Activation of Pro-survival Pathway
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Triclosan
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Unusual Activation of Pro-survival Pathway (UAPP) Click to Show/Hide
Disease Class: Escherichia coli infection [1]
Resistant Disease Escherichia coli infection [ICD-11: 1A03.0]
Resistant Drug Triclosan
Molecule Alteration Expression
Up-regulation
Experimental Note Discovered Using In-vivo Testing Model
In Vitro Model E. coli IFN4 562
Experiment for
Molecule Alteration
Microarray hybridization assay
Experiment for
Drug Resistance
MIC assay
Mechanism Description A FabI NAD+ triclosan ternary complex is formed by face-to-face interaction between the phenol ring of triclosan and the nicotinamide ring of NAD+ in the active site of FabI (enoyl-acyl carrier protein reductase) and therefore highly expressed reductases (narGHJI, garR, hcp and yeaA) and dehydrogenases (fdnGHI, ykgEF, garD, gldA and yeiQ) could bind triclosan which were as the NAD(P) cofactor, thus lowering the effective triclosan concentration.
References
Ref 1 Signature gene expression profile of triclosan-resistant Escherichia coli. J Antimicrob Chemother. 2010 Jun;65(6):1171-7. doi: 10.1093/jac/dkq114. Epub 2010 Apr 21.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.