General Information of the Molecule (ID: Mol00961)
Name
Ethidium resistance protein (EMRE) ,Pseudomonas aeruginosa
Synonyms
qacF; emrE; CAZ10_01525; CGU42_14710; DT376_08255; E4V10_08075; E5D53_06015; ECC04_029850; GNQ48_04330; IPC111_10130; IPC112_11955; IPC113_21010; IPC114_15435; IPC115_21895; IPC116_07445; IPC117_13035; IPC118_14365; IPC119_19225; IPC120_13415; IPC121_04700; IPC122_19705; IPC123_10700; IPC124_11850; IPC125_15685; IPC126_12045; IPC127_24310; IPC128_20585; IPC1295_07910; IPC129_22120; IPC1306_06520; IPC1307_14550; IPC130_21585; IPC1310_15780; IPC1311_13730; IPC1312_14020; IPC1313_14790; IPC1314_17675; IPC1315_15730; IPC1316_01990; IPC1317_20870; IPC1318_01540; IPC1319_01565; IPC131_00995; IPC1320_07235; IPC1321_15480; IPC1322_06185; IPC1323_06805; IPC1324_06810; IPC1325_01560; IPC1326_01560; IPC1327_01560; IPC1328_13205; IPC1329_15165; IPC132_05115; IPC1331_04465; IPC1332_13740; IPC1333_09990; IPC1334_11330; IPC1335_04920; IPC1336_07425; IPC1337_01650; IPC1338_15555; IPC1339_15375; IPC133_01565; IPC1340_13945; IPC1341_14405; IPC1342_01455; IPC1343_01565; IPC1345_09540; IPC1346_10675; IPC1347_04740; IPC1348_15570; IPC1349_00690; IPC134_00990; IPC135_01565; IPC137_20225; IPC139_07480; IPC140_04920; IPC141_01570; IPC143_06390; IPC144_06980; IPC145_01570; IPC146_06075; IPC1474_13830; IPC1476_06705; IPC1477_09170; IPC1478_04470; IPC1479_12565; IPC147_09320; IPC1480_11880; IPC1481_04360; IPC1482_01560; IPC1485_07045; IPC1486_02225; IPC1487_07880; IPC1489_06135; IPC148_11425; IPC1491_01620; IPC1494_11855; IPC1495_07595; IPC1496_05945; IPC1498_15600; IPC1499_06665; IPC149_06070; IPC1500_12105; IPC1501_14840; IPC1502_13785; IPC1503_13850; IPC1504_10570; IPC1505_01855; IPC1506_20965; IPC1507_20265; IPC1508_06345; IPC1509_09460; IPC150_09060; IPC1510_00930; IPC1511_09015; IPC1512_18795; IPC1513_06930; IPC1514_15400; IPC1515_16655; IPC1516_11610; IPC1517_06880; IPC1518_03930; IPC1519_06065; IPC151_09050; IPC1520_02015; IPC1521_06525; IPC1522_06240; IPC152_06975; IPC153_01570; IPC154_20580; IPC155_21475; IPC156_20655; IPC157_24080; IPC1583_06300; IPC1584_09385; IPC1585_01565; IPC1586_10105; IPC1587_05785; IPC1588_02005; IPC1589_11005; IPC158_25780; IPC1591_01565; IPC1592_01565; IPC1593_15130; IPC1594_10140; IPC1595_01840; IPC1596_06255; IPC1597_05910; IPC1598_05700; IPC1599_10710; IPC159_23025; IPC1600_01560; IPC1601_14200; IPC1602_05240; IPC1603_06525; IPC1604_15475; IPC1605_01175; IPC1606_08240; IPC161_06535; IPC162_16675; IPC163_15040; IPC164_15490; IPC165_15045; IPC166_16360; IPC167_14665; IPC168_21810; IPC169_15065; IPC170_15355; IPC171_09885; IPC172_01565; IPC173_01565; IPC174_02320; IPC175_04885; IPC176_01995; IPC177_03335; IPC178_10800; IPC179_01345; IPC180_01560; IPC181_01560; IPC182_13570; IPC183_05820; IPC184_18590; IPC26_05280; IPC27_14305; IPC29_05570; IPC30_06520; IPC31_07745; IPC32_10065; IPC33_14965; IPC34_05855; IPC35_05850; IPC36_10190; IPC37_09220; IPC38_06130; IPC40_05280; IPC41_01565; IPC42_01565; IPC43_13675; IPC44_12655; IPC45_05550; IPC46_05360; IPC47_01590; IPC48_01565; IPC49_01565; IPC50_01565; IPC51_05220; IPC54_16865; IPC55_14250; IPC56_15165; IPC574_07455; IPC575_15630; IPC576_09675; IPC577_11880; IPC578_07460; IPC579_07895; IPC57_05485; IPC580_15420; IPC582_07450; IPC584_16115; IPC586_07465; IPC589_16680; IPC58_01625; IPC596_09650; IPC597_05335; IPC598_07825; IPC599_10385; IPC59_13705; IPC600_07530; IPC601_10040; IPC602_10460; IPC603_01580; IPC604_01560; IPC605_01560; IPC606_23180; IPC607_09455; IPC608_04710; IPC609_12330; IPC60_12915; IPC610_07855; IPC611_01565; IPC612_01560; IPC613_01560; IPC614_08185; IPC615_01570; IPC616_01570; IPC618_01570; IPC620_01590; IPC621_00465; IPC622_11400; IPC623_13455; IPC624_01560; IPC625_12015; IPC627_08180; IPC629_13880; IPC630_06460; IPC632_02000; IPC633_00980; IPC634_02000; IPC64_14630; IPC65_01470; IPC66_07820; IPC67_01570; IPC68_01575; IPC70_15470; IPC71_04780; IPC72_08430; IPC737_05875; IPC73_07640; IPC74_18665; JEV80_16765; NCTC13621_03545; PA52Ts2_0763; PAMH19_2703; Multidrug efflux SMR transporter; Multidrug transporter; SMR multidrug efflux transporter
    Click to Show/Hide
Molecule Type
Protein
Gene Name
qacF
Sequence
MTNYLYLAIAIAAEVVATTSLKAVAGFSKPLPLLLVVGGYVLAFSMLVLVMRTLPVGVVY
AIWSGLGIVLVSLVAMFVYGQRLDPAALLGIGLIIAGVLVIQLFSRASGH
    Click to Show/Hide
Uniprot ID
A0A071KTJ7_PSEAI
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pseudomonadales
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas aeruginosa
Type(s) of Resistant Mechanism of This Molecule
  IDUE: Irregularity in Drug Uptake and Drug Efflux
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Homidium bromide
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Irregularity in Drug Uptake and Drug Efflux (IDUE) Click to Show/Hide
Disease Class: Pseudomonas aeruginosa infection [1]
Resistant Disease Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
Resistant Drug Homidium bromide
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli pXZL1582 668369
Experiment for
Molecule Alteration
PCR and DNA sequencing assay
Experiment for
Drug Resistance
Luria-Bertani (LB) broth and agar dilution assay
Mechanism Description EmrE can pump out toxic compounds such as methyl viologen and play an important role in the intrinsic resistance of P. aeruginosa to aminoglycosides and cationic dyes.
References
Ref 1 Contributions of MexAB-OprM and an EmrE homolog to intrinsic resistance of Pseudomonas aeruginosa to aminoglycosides and dyes. Antimicrob Agents Chemother. 2003 Jan;47(1):27-33. doi: 10.1128/AAC.47.1.27-33.2003.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.