Molecule Information
General Information of the Molecule (ID: Mol00957)
Name |
Erythromycin esterase (EREA2)
,Providencia stuartii
|
||||
---|---|---|---|---|---|
Synonyms |
ereA2; Erythromycin esterase
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
ereA2
|
||||
Sequence |
MTWRTTRTLLQPQKLEFNEFEILNPVVEGARIVGIGEGAHFVAEFSLARASLIRYFVERH
DFNAIGLECGAIQASRLSEWLNSTAGAHELERFSDTLTFSLYGSVLIWVKSYLRESGRKL QLVGIDLPNTLNPRDDLAQLAEIIQVIDHLMKPHVDALTQLLTSIDGQSAVISSAKWGEL ETAQQEKAISGVTRLKLRLASLAPVLKNHVNSDFFRKASDRIESIEYTLETLRVMKAFFD GTSLEGDTSVRDSYMAGVVDGMVRANPDVRIILLAHNNHLQKTPVSFSGELTAVPMGQHL AEREEGDYRAIAFTHLGLTVPEMHFPSPDSPLGFSVVTTPADAIREDSVEQYVIDACGKE DSCLTLTDDPMEAKRMRSQSASVETNLSEAFDAIVCVPSAGKDSLVAL Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
DISM: Drug Inactivation by Structure Modification
Drug Resistance Data Categorized by Drug
Approved Drug(s)
3 drug(s) in total
Clarithromycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Community-acquired pneumonia | [1] | |||
Resistant Disease | Community-acquired pneumonia [ICD-11: CA40.2] | |||
Resistant Drug | Clarithromycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
Escherichia coli TOP10 | 83333 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
Mechanism Description | One mechanism of macrolide resistance is via drug inactivation: enzymatic hydrolysis of the macrolactone ring catalyzed by erythromycin esterases, EreA and EreB. |
Erythromycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Community-acquired pneumonia | [1] | |||
Resistant Disease | Community-acquired pneumonia [ICD-11: CA40.2] | |||
Resistant Drug | Erythromycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
Escherichia coli TOP10 | 83333 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
Mechanism Description | One mechanism of macrolide resistance is via drug inactivation: enzymatic hydrolysis of the macrolactone ring catalyzed by erythromycin esterases, EreA and EreB. |
Roxithromycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Drug Inactivation by Structure Modification (DISM) | ||||
Disease Class: Community-acquired pneumonia | [1] | |||
Resistant Disease | Community-acquired pneumonia [ICD-11: CA40.2] | |||
Resistant Drug | Roxithromycin | |||
Molecule Alteration | Expression | Up-regulation |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Escherichia coli BL21(DE3) | 469008 | ||
Escherichia coli TOP10 | 83333 | |||
Experiment for Molecule Alteration |
Whole genome sequence assay; Allelic frequency measurement assay | |||
Experiment for Drug Resistance |
Disk diffusion test assay; E-strip test assay | |||
Mechanism Description | One mechanism of macrolide resistance is via drug inactivation: enzymatic hydrolysis of the macrolactone ring catalyzed by erythromycin esterases, EreA and EreB. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.