Molecule Information

General Information of the Molecule (ID: Mol00947)

• Name: Elongation factor Tu (TUF) ,Enterococcus gallinarum
• Synonyms: tufB; Fragment
• Molecule Type: Protein
• Gene Name: tufB
• Sequence:
  GAILVVSATDGPMPQTREHILLSRQVGVKHLIVFLNKIDLVDDEELIDLVEMEVRELLSE
  YNFPGDDIPVIKGSALKALEGDPDAEAAIMELMDTVDSYIPTPERDTDKPLLLPVEDVFS
  ITGRGTVASGRIDRGTVRVGDEVEIVGIKPETQKAVVTGVEMFRKTMDFGEAGDNVGVLL
  RGITRDEIERGQVLAKPGSITPHTKFQAEVYVLTKEEGGRHTPFFNNYRPQFYFRTTDVT
  GNITLPEGTE
• Uniprot ID: Q9EZY1_ENTGA

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus gallinarum

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Investigative Drug(s) 1 drug(s) in total

Elfamycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Enterococci gallinarum infection [1]

• Resistant Disease: Enterococci gallinarum infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Elfamycin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Enterococcus avium strain NCTC9938; 33945
• In Vitro Model: Enterococcus casseliflavus strain NCIMB11449; 37734
• In Vitro Model: Enterococcus durans strain NCTC8174; 53345
• In Vitro Model: Enterococcus faecalis strain NCTC775; 1351
• In Vitro Model: Enterococcus faecium strain NCTC 7171; 1352
• In Vitro Model: Enterococcus gallinarum strain NCTC11428; 1353
• In Vitro Model: Enterococcus hirae strain NCIMB6459; 1354
• In Vitro Model: Enterococcus raffinosus strain NCTC 12192; 1989
• Experiment for Drug Resistance: Agar dilution assay
• Mechanism Description: Among enterococci, susceptibility or resistance to elfamycins appears to be determined by the bacterial protein synthesis elongation factor EF-Tu. E.faecium, E.durans, and E.hirae were susceptible to the elfamycins, while isolates of E.faecalis and all other species tested were resistant. Elfamycin resistance in E.faecalis ATCC7080 was mediated by the intrinsic resistance of its EF-Tu.

References

• Ref 1: Differential susceptibilities of enterococcal species to elfamycin antibiotics. J Clin Microbiol. 1994 Aug;32(8):2016-8. doi: 10.1128/jcm.32.8.2016-2018.1994.