General Information of the Molecule (ID: Mol00946)
Name
Elongation factor Tu (TUF) ,Enterococcus avium
Synonyms
tufB; Fragment
    Click to Show/Hide
Molecule Type
Protein
Gene Name
tufB
Sequence
GAILVVSATDGPMPQTREHILLSRQVGVKHLIVFLNKVDLVDDEELIDLVEMEVRELLSE
YGFPGDDIPVLKGSALKALEGDPEQEQVILDLMDTVDEYIPTPERDTDKPFLLPVEDVFS
ITGRGTVASGRIDRGEVKVGDEVEIIGIKPEIQKAVVTGLEMFRKTLDYGEAGDNVGVLL
RGITRDEIERGQVLAKPGSITPHTKFSAEVYVLTKEEGGRHTPS
    Click to Show/Hide
Uniprot ID
Q9EZZ1_ENTAV
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus avium
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Elfamycin
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Enterococci avium infection [1]
Resistant Disease Enterococci avium infection [ICD-11: 1A00-1C4Z]
Resistant Drug Elfamycin
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Enterococcus avium strain NCTC9938 33945
Enterococcus casseliflavus strain NCIMB11449 37734
Enterococcus durans strain NCTC8174 53345
Enterococcus faecalis strain NCTC775 1351
Enterococcus faecium strain NCTC 7171 1352
Enterococcus gallinarum strain NCTC11428 1353
Enterococcus hirae strain NCIMB6459 1354
Enterococcus raffinosus strain NCTC 12192 1989
Experiment for
Drug Resistance
Agar dilution assay
Mechanism Description Among enterococci, susceptibility or resistance to elfamycins appears to be determined by the bacterial protein synthesis elongation factor EF-Tu. E.faecium, E.durans, and E.hirae were susceptible to the elfamycins, while isolates of E.faecalis and all other species tested were resistant. Elfamycin resistance in E.faecalis ATCC7080 was mediated by the intrinsic resistance of its EF-Tu.
References
Ref 1 Differential susceptibilities of enterococcal species to elfamycin antibiotics. J Clin Microbiol. 1994 Aug;32(8):2016-8. doi: 10.1128/jcm.32.8.2016-2018.1994.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.