Molecule Information
General Information of the Molecule (ID: Mol00946)
Name |
Elongation factor Tu (TUF)
,Enterococcus avium
|
||||
---|---|---|---|---|---|
Synonyms |
tufB; Fragment
Click to Show/Hide
|
||||
Molecule Type |
Protein
|
||||
Gene Name |
tufB
|
||||
Sequence |
GAILVVSATDGPMPQTREHILLSRQVGVKHLIVFLNKVDLVDDEELIDLVEMEVRELLSE
YGFPGDDIPVLKGSALKALEGDPEQEQVILDLMDTVDEYIPTPERDTDKPFLLPVEDVFS ITGRGTVASGRIDRGEVKVGDEVEIIGIKPEIQKAVVTGLEMFRKTLDYGEAGDNVGVLL RGITRDEIERGQVLAKPGSITPHTKFSAEVYVLTKEEGGRHTPS Click to Show/Hide
|
||||
Uniprot ID | |||||
Click to Show/Hide the Complete Species Lineage | |||||
Type(s) of Resistant Mechanism of This Molecule
ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Investigative Drug(s)
1 drug(s) in total
Elfamycin
Drug Resistance Data Categorized by Their Corresponding Mechanisms | ||||
Aberration of the Drug's Therapeutic Target (ADTT) | ||||
Disease Class: Enterococci avium infection | [1] | |||
Resistant Disease | Enterococci avium infection [ICD-11: 1A00-1C4Z] | |||
Resistant Drug | Elfamycin | |||
Molecule Alteration | Expression | Inherence |
||
Experimental Note | Identified from the Human Clinical Data | |||
In Vitro Model | Enterococcus avium strain NCTC9938 | 33945 | ||
Enterococcus casseliflavus strain NCIMB11449 | 37734 | |||
Enterococcus durans strain NCTC8174 | 53345 | |||
Enterococcus faecalis strain NCTC775 | 1351 | |||
Enterococcus faecium strain NCTC 7171 | 1352 | |||
Enterococcus gallinarum strain NCTC11428 | 1353 | |||
Enterococcus hirae strain NCIMB6459 | 1354 | |||
Enterococcus raffinosus strain NCTC 12192 | 1989 | |||
Experiment for Drug Resistance |
Agar dilution assay | |||
Mechanism Description | Among enterococci, susceptibility or resistance to elfamycins appears to be determined by the bacterial protein synthesis elongation factor EF-Tu. E.faecium, E.durans, and E.hirae were susceptible to the elfamycins, while isolates of E.faecalis and all other species tested were resistant. Elfamycin resistance in E.faecalis ATCC7080 was mediated by the intrinsic resistance of its EF-Tu. |
References
If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.