Molecule Information

General Information of the Molecule (ID: Mol00944)

• Name: DUF2154 domain-containing protein (LIAF) ,Enterococcus faecalis
• Synonyms: GTI81_10090
• Molecule Type: Protein
• Gene Name: GTI81_10090
• Sequence:
  MNNPWRFFIVAEALLFILALWQIVHNPGLAVLLTIGVLLVAYVSRKASKTHFNNFQFVLG
  VVFIVIGAMNSTAVWFMLIFGVLFIGLKGFEISGVDIAERAPWRKKQMIMVETAAKEPKN
  GKRFKRRWVANERIGNNIYEWDDINIDLISGDTIIDLGNTLLPKEDNIIIIRKGFGRTRI
  LVPLGVAILLEHSTFYGTVRFEEEKYQLKNESLKIYSNDYDTNLRRLKIMTNTLVGDVEV
  IRV
• Uniprot ID: A0A6I4XRK1_ENTFL

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Enterococcaceae
Genus: Enterococcus
Species: Enterococcus faecalis

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Daptomycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Bacteremia [1]

• Resistant Disease: Bacteremia [ICD-11: MA15.0]
• Resistant Drug: Daptomycin
• Molecule Alteration: Frameshift mutation; p.170Idel
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Enterococcus faecalis S613; 699185
• In Vitro Model: Enterococcus faecalis R712; 699186
• Experiment for Molecule Alteration: Whole genome sequence assay; Allelic frequency measurement assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: The daptomycin-resistant isolate - had changes in the structure of the cell envelope and alterations in membrane permeability and membrane potential.

References

• Ref 1: Genetic basis for in vivo daptomycin resistance in enterococci. N Engl J Med. 2011 Sep 8;365(10):892-900. doi: 10.1056/NEJMoa1011138.