Molecule Information

General Information of the Molecule (ID: Mol00906)

• Name: Dihydrofolate reductase type 6 (DFRA6) ,Proteus mirabilis
• Synonyms: Dihydrofolate reductase type VI; dfrVI
• Molecule Type: Protein
• Gene Name: dhfrVI
• Sequence:
  MKISLMAAVSENGVIGSGLDIPWHVQGEQLLFKAMTYNQWLLVGRKTFDSMGKLPNRKYA
  VVTRSKIISNDPDVVYFASVESALAYLNNATAHIFVSGGGEIYKALIDQADVIHLSVIHK
  HISGDVFFPPVPQGFKQTFEQSFSSNIDYTYQIWAKG
• Function: Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis (By similarity).
• Uniprot ID: DYR6_PROMI

Kingdom: N.A.
Phylum: Actinobacteria
Class: Actinomycetia
Order: Streptomycetales
Family: Streptomycetaceae
Genus: Streptomyces
Species: Streptomyces actuosus

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Trimethoprim

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Proteus mirabilis infection [1]

• Resistant Disease: Proteus mirabilis infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Trimethoprim
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli strain JM101; 83333
• In Vitro Model: Escherichia coli strain k12 JM103; 83333
• In Vitro Model: Proteus mirabilis strain J120; 584
• Experiment for Molecule Alteration: Chain termination method assay
• Mechanism Description: High-level resistance to trimethoprim (Tp) (MIC > 1000 mg/L) is mediated by dihydrofolate reductases (DHFRs) which are resistant to the drug, The gene encoding the type VI DHFR was isolated from P. mirabilis strain J120 (pUk672).

Disease Class: Escherichia coli infection [1]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Trimethoprim
• Molecule Alteration: Expression; Acquired
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli strain JM101; 83333
• In Vitro Model: Escherichia coli strain k12 JM103; 83333
• In Vitro Model: Proteus mirabilis strain J120; 584
• Experiment for Molecule Alteration: Chain termination method assay
• Mechanism Description: High-level resistance to trimethoprim (Tp) (MIC > 1000 mg/L) is mediated by dihydrofolate reductases (DHFRs) which are resistant to the drug, The gene encoding the type VI DHFR was isolated from P. mirabilis strain J120 (pUk672). The hybrid plasmids were transformed into competent Escherichia coli kl2 JM103 and clones containing the DHFR gene were selected on a medium containing trimethoprim lactate (Wellcome) 100 mg/L, ampicillin 100 mg/L, isopropyl-Beta-D-galactoside and 5-bromo-4-chloro-3-indolyl-Beta-D-gal-actopyranoside (X-gal).

References

• Ref 1: Nucleotide sequence of dihydrofolate reductase type VI. J Med Microbiol. 1991 Oct;35(4):214-8. doi: 10.1099/00222615-35-4-214.