Molecule Information

General Information of the Molecule (ID: Mol00904)

• Name: Dihydrofolate reductase (DHFR) ,Escherichia coli
• Synonyms: dfrA17; BVL39_26665; HmCms169_04568
• Molecule Type: Protein
• Gene Name: dfrA27
• Sequence:
  MKISLMAAKARNGVIGCGSDIPWNAKGEQLLFKAITYNQWLLVGRKTFEAMGALPNRKYA
  VVSRSGSVATNDDVVVFPSIEAAMRELKTLTNHVVVSGGGEIYKSLIAHADTLHISTIDS
  EPEGNVFFPEIPKEFNVVFEQEFHSNINYRYQIWQRG
• Function: Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.
• Uniprot ID: B2ZNP4_ECOLX

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Enterobacterales
Family: Enterobacteriaceae
Genus: Escherichia
Species: Escherichia coli

Type(s) of Resistant Mechanism of This Molecule

  ADTT: Aberration of the Drug's Therapeutic Target

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Trimethoprim

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Aberration of the Drug's Therapeutic Target (ADTT)

Disease Class: Urinary tract infection [1]

• Resistant Disease: Urinary tract infection [ICD-11: GC08.1]
• Resistant Drug: Trimethoprim
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli 1387; 562
• Experiment for Molecule Alteration: PCR amplification and sequence alignments assay
• Mechanism Description: The most common resistant mechanism involves expressing trimethoprim insensitive variants of DHFR within mobile genetic elements, such as plasmids, transposons and integrons.

References

• Ref 1: dfrA27, a new integron-associated trimethoprim resistance gene from Escherichia coli. J Antimicrob Chemother. 2009 Feb;63(2):405-6. doi: 10.1093/jac/dkn474. Epub 2008 Nov 13.