General Information of the Molecule (ID: Mol00894)
Name
Dihydrofolate reductase (DHFR) ,Vibrio cholerae
Synonyms
dhfR18; D6U24_19495
    Click to Show/Hide
Molecule Type
Protein
Gene Name
dfr18
Sequence
MNKEIQFSMIVARGVNGEIGQDGDLPWHVEGVRLKEDLKRFKAITMGKTLVMGRKTFESI
PNGLPGRNVIVLTREPYDKADITERGDGTFVAWGNSCHLFEVAEHLGVTEIIVAGGAEIY
NLHKDVITKVFETKVLRAYPAADTHVDVFWESPGYDTEGRQWRVTSRGHIIENGSFTIAT
TYER
    Click to Show/Hide
Function
Key enzyme in folate metabolism. Catalyzes an essential reaction for de novo glycine and purine synthesis, and for DNA precursor synthesis.
    Click to Show/Hide
Uniprot ID
Q8VVN6_VIBCL
        Click to Show/Hide the Complete Species Lineage
Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Vibrionales
Family: Vibrionaceae
Genus: Vibrio
Species: Vibrio cholerae
Type(s) of Resistant Mechanism of This Molecule
  ADTT: Aberration of the Drug's Therapeutic Target
Drug Resistance Data Categorized by Drug
Approved Drug(s)
1 drug(s) in total
Click to Show/Hide the Full List of Drugs
Trimethoprim
Click to Show/Hide
Drug Resistance Data Categorized by Their Corresponding Mechanisms
       Aberration of the Drug's Therapeutic Target (ADTT) Click to Show/Hide
Disease Class: Vibrio cholerae infection [1]
Resistant Disease Vibrio cholerae infection [ICD-11: 1A00.0]
Resistant Drug Trimethoprim
Molecule Alteration Expression
Inherence
Experimental Note Identified from the Human Clinical Data
In Vitro Model Escherichia coli DH5alpha 668369
Escherichia coli k-12 strain TOP10 83333
Vibrio cholerae O1 C10488 127906
Vibrio cholerae O1 strain CO943 127906
Vibrio cholerae O139 1811/98 45888
Vibrio cholerae O139 2055 45888
Vibrio cholerae O139 AS207 45888
Vibrio cholerae O139 E712 45888
Vibrio cholerae O139 HkO139-SXTS 45888
Vibrio cholerae O139 strain MO10 345072
Experiment for
Molecule Alteration
Sequencing assay
Mechanism Description Many recent Asian clinical Vibrio cholerae E1 Tor O1 and O139 isolates are resistant to the antibiotics sulfamethoxazole (Su), trimethoprim (Tm), chloramphenicol (Cm), and streptomycin (Sm). The corresponding resistance genes are located on large conjugative elements (SXT constins) that are integrated into prfC on the V. cholerae chromosome. The DNA sequences of the antibiotic resistance genes in the SXT constin in MO10, an O139 isolate. In SXT(MO10), these genes are clustered within a composite transposon-like structure found near the element's 5' end. The genes conferring resistance to Cm (floR), Su (sulII), and Sm (strA and strB) correspond to previously described genes, whereas the gene conferring resistance to Tm, designated dfr18, is novel.
References
Ref 1 Molecular analysis of antibiotic resistance gene clusters in vibrio cholerae O139 and O1 SXT constins. Antimicrob Agents Chemother. 2001 Nov;45(11):2991-3000. doi: 10.1128/AAC.45.11.2991-3000.2001.

If you find any error in data or bug in web service, please kindly report it to Dr. Sun and Dr. Zhang.