Molecule Information

General Information of the Molecule (ID: Mol00878)

Name	Chloramphenicol resistance protein (CMX) ,Corynebacterium glutamicum
Synonyms	cmx; Fragment Click to Show/Hide
Molecule Type	Protein
Gene Name	cmx
Sequence	FSLLLITRVLSALANTGFLAVALSTATTLVPANQKGRALSILLSGTTIATVVGVPAGALL GTALGWRTTFWAIAILCIPAAVGVIRGVTNNVGRSETSATSPRLRVELSQLATPRLILAM ALGALINGGTFAAFTFLAPIVTETAGLAEAWVSVALVMFGIGSFLGVTIAGRLSDQRPGL VLAVGGPLLLTGWIVLAV Click to Show/Hide
Uniprot ID	A0A345Z5Q8_CORST
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Actinobacteria Class: Actinomycetia Order: Corynebacteriales Family: Corynebacteriaceae Genus: Corynebacterium Species: Corynebacterium glutamicum

Type(s) of Resistant Mechanism of This Molecule

IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Chloramphenicol

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Irregularity in Drug Uptake and Drug Efflux (IDUE)		Click to Show/Hide
Disease Class: Bacterial infection			[1], [2]
Resistant Disease	Bacterial infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Chloramphenicol		Drug Info
Molecule Alteration	Expression	Up-regulation
Experimental Note	Identified from the Human Clinical Data
In Vitro Model	Escherichia coli S17-1		1227813
	Corynebacterium glutamicum ATCC 13032		196627
	Corynebacterium glutamicum CX61		1718
	Corynebacterium glutamicum CX73		1718
	Corynebacterium glutamicum RM3		1718
	Escherichia coli DH5alphaMCR		668369
Experiment for Molecule Alteration	Whole genome sequence assay
Mechanism Description	The central region of Tn5564 encodes the chloramphenicol resistance gene cmx, specifying a transmembrane chloramphenicol efflux protein, and an open reading frame homologous to transposases of insertion sequences identified in Arthrobacter nicotinovorans and Bordetella pertussis.

References

Ref 1	Multifocal outbreaks of metallo-beta-lactamase-producing Pseudomonas aeruginosa resistant to broad-spectrum beta-lactams, including carbapenems. Antimicrob Agents Chemother. 1996 Feb;40(2):349-53. doi: 10.1128/AAC.40.2.349.
Ref 2	Corynebacterium striatum chloramphenicol resistance transposon Tn5564: genetic organization and transposition in Corynebacterium glutamicum. Plasmid. 1998 Sep;40(2):126-39. doi: 10.1006/plas.1998.1362.