Molecule Information

General Information of the Molecule (ID: Mol00877)

• Name: Chloramphenicol acetyltransferase gene (CATS) ,Streptococcus pyogenes
• Synonyms: CATS; Fragment
• Molecule Type: Protein
• Gene Name: CATS
• Sequence:
  FTNIPCTYSMTVKLDITQIKKKRMKLYPAMLYYLATIVNRHSEFRTAINQEGELGIYDEM
  IPSYTIFHEDTETFSNLWTPYIPDFEAFSMAYANDMQRYGSNYGMIGKPDIPENVFNVSM
  IPWSTFDSFNLNLQKGYDYLIPIFTMGKYYRDDEKIILPLAIQV
• Uniprot ID: Q54803_STRPY

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Streptococcaceae
Genus: Streptococcus
Species: Streptococcus pyogenes

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Streptococci infection [1]

• Resistant Disease: Streptococci infection [ICD-11: 1B54.2]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Enterococcus faecalis strain JH2-2; 1320322
• In Vitro Model: Enterococcus faecalis strain pIP1326g; 1351
• In Vitro Model: Enterococcus faecalis strain pIP655; 1351
• In Vitro Model: Enterococcus faecalis strain pIP683; 1351
• In Vitro Model: Enterococcus faecalis strain pIP687; 1351
• In Vitro Model: Enterococcus faecium strain pIP1182; 1352
• In Vitro Model: Enterococcus faecium strain pIP1535; 1352
• In Vitro Model: Enterococcus faecium strain pIP1538; 1352
• In Vitro Model: Enterococcus faecium strain pIP1539; 1352
• In Vitro Model: Enterococcus faecium strain pIP1687; 1352
• In Vitro Model: Enterococcus faecium strain pIP713; 1352
• In Vitro Model: Streptococci strain A451; 36470
• In Vitro Model: Streptococci strain A453; 36470
• In Vitro Model: Streptococci strain A456; 36470
• In Vitro Model: Streptococci strain B109; 1319
• In Vitro Model: Streptococci strain B117; 1319
• In Vitro Model: Streptococci strain B118; 1319
• In Vitro Model: Streptococci strain B120; 1319
• In Vitro Model: Streptococci strain B126; 1319
• In Vitro Model: Streptococci strain B127; 1319
• In Vitro Model: Streptococci strain BM132; 1319
• In Vitro Model: Streptococci strain BM137; 36470
• In Vitro Model: Streptococci strain BM140; 1319
• In Vitro Model: Streptococci strain G44; 1320
• In Vitro Model: Streptococci strain G52; 1320
• In Vitro Model: Streptococci strain G54; 1320
• Experiment for Molecule Alteration: Southern blotting assay
• Mechanism Description: An assay based on the utilization of degenerate primers that enable enzymatic amplification of an internal fragment of cat genes known to be present in gram-positive cocci was developed to identify the genes encoding chloramphenicol resistance in streptococci and enterococci. The functionality of this system was illustrated by the detection of cat genes belonging to four different hydridization classes represented by the staphylococcal genes catpC221, catpC194, catpSCS7, and the clostridial gene catP, and by the characterization of a new streptococcal cat gene designated catS.

References

• Ref 1: Study of heterogeneity of chloramphenicol acetyltransferase (CAT) genes in streptococci and enterococci by polymerase chain reaction: characterization of a new CAT determinant. Antimicrob Agents Chemother. 1993 Dec;37(12):2593-8. doi: 10.1128/AAC.37.12.2593.