Molecule Information

General Information of the Molecule (ID: Mol00875)

Name	Chloramphenicol acetyltransferase 2 (CATII) ,Haemophilus influenzae
Synonyms	Chloramphenicol acetyltransferase II; CAT-II Click to Show/Hide
Molecule Type	Protein
Gene Name	cat-IIH
Sequence	MNFTRIDLNTWNRREHFALYRQQIKCGFSLTTKLDITAFRTALAETDYKFYPVMIYLISR VVNQFPEFRMAMKDNALIYWDQTDPVFTVFHKETETFSALFCRYCPDISEFMAGYNAVMA EYQHNTALFPQGALPENHLNISSLPWVSFDGFNLNITGNDDYFAPVFTMAKFQQEDNRVL LPVSVQVHHAVCDGFHAARFINTLQMMCDNILK Click to Show/Hide
Function	This enzyme is an effector of chloramphenicol resistance in bacteria. Click to Show/Hide
Uniprot ID	CAT2_HAEIF
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Pasteurellales Family: Pasteurellaceae Genus: Haemophilus Species: Haemophilus influenzae

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Chloramphenicol

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Haemophilus influenzae infection			[1]
Resistant Disease	Haemophilus influenzae infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Chloramphenicol		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli strain JM 101		562
Mechanism Description	Bacterial resistance to the antibiotic chloramphenicol, an inhibitor of the peptidyltransferase activity of prokaryotic ribosomes, is commonly conferred by the enzyme chloramphenicol acetyltransferase (CAT,EC2.3.1.28). The enzyme catalyses transfer of the acetyl group of acetyl-CoA to the primary (C-3) hydroxy group of chloramphenicol, yielding 3-acetylchloramphenicol, which fails to bind to bacterial ribosomes. Three classes of CAT variant have been characterized among Gram-negative bacteria, designated typesI, II and III.

References

Ref 1	Nucleotide sequences of genes encoding the type II chloramphenicol acetyltransferases of Escherichia coli and Haemophilus influenzae, which are sensitive to inhibition by thiol-reactive reagents. Biochem J. 1990 Dec 1;272(2):505-10. doi: 10.1042/bj2720505.