Molecule Information

General Information of the Molecule (ID: Mol00868)

• Name: Chloramphenicol acetyltransferase (CAT) ,Clostridium butyricum
• Synonyms: CAT
• Molecule Type: Protein
• Gene Name: catB
• Sequence:
  MNFNLIDINHWSRKPYFEHYLNNVKCTYSMTANIEITDLLYEIKLKNIKFYPTLIYMIAT
  VVNNHKEFRICFDHKGSLGYWDSMNPSYTIFHKENETFSSIWTEYNKSFLRFYSDYLDDI
  KNYGNIMKFTPKSNEPDNTFSVSSIPWVSFTGFNLNVYNEGTYLIPIFTAGKYFKQENKI
  FIPISIQVHHAICDGYHASRFINEMQELAFSFQEWLENK
• Function: This enzyme is an effector of chloramphenicol resistance in bacteria.
• Uniprot ID: CAT_CLOBU

Kingdom: N.A.
Phylum: Firmicutes
Class: Clostridia
Order: Eubacteriales
Family: Clostridiaceae
Genus: Clostridium
Species: Clostridium butyricum

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Escherichia coli infection [1]

• Resistant Disease: Escherichia coli infection [ICD-11: 1A03.0]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Acquired
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli; 668369
• Experiment for Molecule Alteration: Nucleotide sequence assay
• Mechanism Description: Bacterial resistance to chloramphenicol is most commonly mediated by production of the enzyme chloramphenicol acetyltransferase (CAT), which catalyzes the transfer of an acetyl group from acetyl coenzyme A to the primary hydroxyl group of chloramphenicol (O-acetylation). The O-acetoxy derivatives of chloramphenicol do not bind to bacterial ribosomes and are consequently devoid of antimicrobial activity. Recombinant strains were derivatives of Escherichia coli DH5alpha and were grown in 2YT medium supplemented with ampicillin (100 ug/ml) and chloramphenicol (30 ug/ml) where appropriate. Cloning experiments conducted in this study utilized the Escherichia coli plasmid vector pUC18.

Disease Class: Clostridium butyricum infection [1]

• Resistant Disease: Clostridium butyricum infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli; 668369
• Experiment for Molecule Alteration: Nucleotide sequence assay
• Mechanism Description: Bacterial resistance to chloramphenicol is most commonly mediated by production of the enzyme chloramphenicol acetyltransferase (CAT), which catalyzes the transfer of an acetyl group from acetyl coenzyme A to the primary hydroxyl group of chloramphenicol (O-acetylation). The O-acetoxy derivatives of chloramphenicol do not bind to bacterial ribosomes and are consequently devoid of antimicrobial activity. The five distinct clostridial cat genes that have been cloned include catP and catQ from C. perfringens, catD from Clostridium dificile, and catA and catB from C. butyricum. The C. perfringens genes catP and catQ and the C. difficile gene catD have been sequenced.

References

• Ref 1: Comparative sequence analysis of the catB gene from Clostridium butyricum. Antimicrob Agents Chemother. 1992 Nov;36(11):2548-51. doi: 10.1128/AAC.36.11.2548.