Molecule Information

General Information of the Molecule (ID: Mol00865)

Name	Chloramphenicol acetyltransferase (CAT) ,Clostridium perfringens
Synonyms	CAT Click to Show/Hide
Molecule Type	Protein
Gene Name	catQ
Sequence	MKFNLIDIEDWNRKPYFEHYLNAVRCTYSMTANIEITGLLREIKLKGLKLYPTLIYIITT VVNRHKEFRTCFDQKGKLGYWDSMNPSYTVFHKDNETFSSIWTEYDENFPRFYYNYLEDI RNYSDVLNFMPKTGEPANTINVSSIPWVNFTGFNLNIYNDATYLIPIFTLGKYFQQDNKI LLPMSVQVHHAVCDGYHISRFFNEAQELASNYETWLGEK Click to Show/Hide
Function	This enzyme is an effector of chloramphenicol resistance in bacteria. Click to Show/Hide
Uniprot ID	CAT1_CLOPF
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Firmicutes Class: Clostridia Order: Eubacteriales Family: Clostridiaceae Genus: Clostridium Species: Clostridium perfringens

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Chloramphenicol

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Clostridium perfringens infection			[1]
Resistant Disease	Clostridium perfringens infection [ICD-11: 1A00-1C4Z]		Disease Info
Resistant Drug	Chloramphenicol		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli		668369
	Clostridium perfringens strain CW531		1502
Experiment for Molecule Alteration	Double-stranded dideoxy-chain termination method assay
Mechanism Description	The enzyme chloramphenicol acetyltransferase (CAT) mediates the inactivation of the antibiotic chloramphenicol, a potent inhibitor of prokaryotic peptidyltransferase activity. The active CAT enzyme, which catalyzes the acetyl coenzyme A-dependent acetylation of chloramphenicol, is a trimer of identical subunits of approximately 25 kDa. The nucleotide sequence of the Clostridium perfringens chloramphenicol acetyltransferase (CAT)-encoding resistance determinant, catQ, was determined. Phylogenetic analysis revealed that the CATQ monomer was as closely related to CAT proteins from Staphylococcus aureus and Campylobacter coli as it was to CAT monomers from the clostridia.

References

Ref 1	Relationship between the Clostridium perfringens catQ gene product and chloramphenicol acetyltransferases from other bacteria. Antimicrob Agents Chemother. 1991 Mar;35(3):471-6. doi: 10.1128/AAC.35.3.471.