Molecule Information

General Information of the Molecule (ID: Mol00863)

• Name: Chloramphenicol acetyltransferase (CAT) ,Lactobacillus reuteri
• Molecule Type: Protein
• Gene Name: cat-TC
• Sequence:
  MNFNKIDLDNWKRKEIFNHYLNQQTTFSITTEIDISVLYRNIKQEGYKFYPAFIFLVTRV
  INSNTAFRTGYNSDGELGYWDKLEPLYTIFDGVSKTFSGIWTSVKNDFKEFYDLYLSDVE
  KYNGSGKLFPKTPIPENAFSLSIIPWTSFTGFNLNINNNSNYLLPIITAGKFINKGNSIY
  LPLSLQVHHSVCDGYHAGLFMNSIRNCQIGLMTGFYNIDKPTVLFTVGFLMSLTCPLI
• Function: This enzyme is an effector of chloramphenicol resistance in bacteria.
• Uniprot ID: P94902_LIMRT

Kingdom: N.A.
Phylum: Firmicutes
Class: Bacilli
Order: Lactobacillales
Family: Lactobacillaceae
Genus: Limosilactobacillus
Species: Limosilactobacillus reuteri

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Lactobacillus reuteri infection [1]

• Resistant Disease: Lactobacillus reuteri infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli strain DH5a; 668369
• In Vitro Model: Escherichia coli strain CSR 603; 562
• In Vitro Model: Escherichia coli strain DH5a-CR17; 668369
• In Vitro Model: Escherichia coli strain DH5a-CR36; 668369
• In Vitro Model: Lactobacillus reuteri strain DSM 20016; 557436
• In Vitro Model: Lactobacillus reuteri strain DSM 20016-CR3; 557436
• In Vitro Model: Lactobacillus reuteri strain G4; 1598
• In Vitro Model: Lactobacillus reuteri strain G4-CS1-3; 1598
• Experiment for Molecule Alteration: Hybridization assay
• Mechanism Description: Lactobacillus reuteri G4 contains a 7.0-kb plasmid (pTC82) encoding resistance to chloramphenicol (Cm). Determination of the nucleotide sequence of the genetic determinant (cat-TC) encoding resistance to Cm on pTC82 revealed an open reading frame for a 238-amino-acid Cm acetyltransferase (CAT) monomer. This is the first reported nucleotide sequence of a Cm-resistance determinant from L. reuteri and also the first evidence of adding Lactobacillus to the list of versatile bacterial genera which naturally acquire the cat-pC194 gene in the microbial ecological system.

References

• Ref 1: Molecular characterization of a plasmid-borne (pTC82) chloramphenicol resistance determinant (cat-TC) from Lactobacillus reuteri G4. Plasmid. 1996 Sep;36(2):116-24. doi: 10.1006/plas.1996.0039.