Molecule Information

General Information of the Molecule (ID: Mol00861)

Name	Chloramphenicol 3-O phosphotransferase (CH3OP) ,Streptomyces venezuelae
Synonyms	CPT; SVEN_4064 Click to Show/Hide
Molecule Type	Protein
Gene Name	SVEN_4064
Sequence	MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADG GVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVR CDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP Click to Show/Hide
Function	Inactivates chloramphenicol by catalyzing the transfer of the gamma-phosphate of ATP to the antibiotic's C-3' hydroxyl group. Click to Show/Hide
Uniprot ID	CPT_STRVP
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Actinobacteria Class: Actinomycetia Order: Streptomycetales Family: Streptomycetaceae Genus: Streptomyces Species: Streptomyces venezuelae

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Chloramphenicol

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Streptomyces venezuelae infection			[1]
Resistant Disease	Streptomyces venezuelae infection [ICD-11: 1C43.10]		Disease Info
Resistant Drug	Chloramphenicol		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Escherichia coli JM101		562
	Streptomyces lividans strain M252		1916
Experiment for Molecule Alteration	Dideoxy chain-termination method assay
Experiment for Drug Resistance	Measuring the diameters of inhibition zones around the disks assay
Mechanism Description	The product of the ORF from S. venezuelae as an enzymic effector of Cm resistance in the producing organism by 3'-O-phosphorylation. We suggest the trivial name chloramphenicol 3'-O-phosphotransferase for the enzyme.

References

Ref 1	Inactivation of chloramphenicol by O-phosphorylation. A novel resistance mechanism in Streptomyces venezuelae ISP5230, a chloramphenicol producer. J Biol Chem. 1995 Nov 10;270(45):27000-6. doi: 10.1074/jbc.270.45.27000.