Molecule Information

General Information of the Molecule (ID: Mol00860)

• Name: Chaperone protein ClpB (CLPB) ,Pseudomonas aeruginosa
• Synonyms: PA4542
• Molecule Type: Protein
• Gene Name: clpB
• Gene ID: 879457
• Sequence:
  MRIDRLTSKLQLALSDAQSLAVGHDHPAIEPVHLLSALLEQQGGSIKPLLMQVGFDIAAL
  RSGLNKELDALPKIQSPTGDVNLSQDLARLLNQADRLAQQKGDQFISSELVLLAAMDENT
  RLGKLLLGQGVSRKALENAVANLRGGEAVNDPNVEESRQALDKYTVDMTKRAEEGKLDPV
  IGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQRIINGEVPDGLKDKRLLAL
  DMGALIAGAKFRGEFEERLKAVLNELGKQEGRVILFIDELHTMVGAGKAEGAMDAGNMLK
  PALARGELHCVGATTLDEYRQYIEKDAALERRFQKVLVDEPSEEDTIAILRGLKERYEVH
  HGVSITDGAIIAAAKLSHRYITDRQLPDKAIDLIDEAASRIRMEIDSKPEELDRLDRRLI
  QLKIEREALKKEDDEATRKRLAKLEEDIVKLEREYADLEEIWKSEKAEVQGSAQIQQKIE
  QAKQEMEAARRKGDLESMARIQYQTIPDLERSLQMVDQHGKTENQLLRNKVTDEEIAEVV
  SKWTGIPVSKMLEGEREKLLRMEQELHRRVIGQDEAVVAVSNAVRRSRAGLADPNRPSGS
  FLFLGPTGVGKTELCKALAEFLFDTEEALVRIDMSEFMEKHSVARLIGAPPGYVGFEEGG
  YLTEAIRRKPYSVVLLDEVEKAHPDVFNILLQVLEDGRLTDSHGRTVDFRNTVVVMTSNL
  GSAQIQELAGDREAQRAAVMDAVNAHFRPEFINRIDEVVVFEPLAREQIAGIAEIQLGRL
  RKRLAERELSLELSQEALDKLIAVGFDPVYGARPLKRAIQRWIENPLAQLILAGKFAPGA
  SISAKVEGDEIVFA
• Function: Part of a stress-induced multi-chaperone system, it is involved in the recovery of the cell from heat-induced damage, in cooperation with DnaK, DnaJ and GrpE. Acts before DnaK, in the processing of protein aggregates. Protein binding stimulates the ATPase activity; ATP hydrolysis unfolds the denatured protein aggregates, which probably helps expose new hydrophobic binding sites on the surface of ClpB-bound aggregates, contributing to the solubilization and refolding of denatured protein aggregates by DnaK (By similarity).
• Uniprot ID: CLPB_PSEAE

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Pseudomonadales
Family: Pseudomonadaceae
Genus: Pseudomonas
Species: Pseudomonas aeruginosa

Type(s) of Resistant Mechanism of This Molecule

  UAPP: Unusual Activation of Pro-survival Pathway

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Tobramycin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Unusual Activation of Pro-survival Pathway (UAPP)

Disease Class: Pseudomonas aeruginosa infection [1]

• Resistant Disease: Pseudomonas aeruginosa infection [ICD-11: 1A00-1C4Z]
• Resistant Drug: Tobramycin
• Molecule Alteration: Expression; Up-regulation
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Pseudomonas aeruginosa MPAO1; 1131757
• Experiment for Molecule Alteration: SRM analysis
• Experiment for Drug Resistance: MIC assay
• Mechanism Description: The extracellular polysaccharide layer of biofilm can prolong the time of bactericide penetration into the central cell cluster. The proteomic response of Pseudomonas aeruginosa depends on the level of tobramycin experienced by the cells after exposure to various sub inhibitory levels (0.1-1) u Tobramycin (g / ml) can induce different proteins. Bacterial cells exposed to low levels of tobramycin showed elevated levels of enzymes that metabolize and synthesize amino acids that may alter drug sensitivity. Inactivation of ibpA did not yield significant tobramycin MIC changes. However, inactivation of two heat shock proteins/proteases ibpA/clpB, ibpA/PA0779, or ibpA/hslV led to increased tobramycin sensitivity changes in P. aeruginosa.

References

• Ref 1: Dynamic Proteome Response of Pseudomonas aeruginosa to Tobramycin Antibiotic Treatment. Mol Cell Proteomics. 2015 Aug;14(8):2126-37. doi: 10.1074/mcp.M115.050161. Epub 2015 May 27.