Molecule Information

General Information of the Molecule (ID: Mol00846)

Name	Beta-lactamase-like protein (VARG) ,Vibrio cholerae
Synonyms	D6U24_07385; ERS013186_01425; ERS013199_01612; ERS013207_02023 Click to Show/Hide
Molecule Type	Protein
Gene Name	varG
Gene ID	57740219
Sequence	MKLSTLALAPITAALLTFNASAKGHDHDNQRAIFFPGETVQDTVKVEVEPSATQSLKLGQ KINNLYERQFDNSQATVQKLGKNTYWIGVNYYNATVVVNEDSVLLIDPLGDGRIDALFKG VQSITNKPITTIMYSHYHLDHLGGGNQLVDLIKKNYPKVDKIRVIASQTVADKINQHAEV GENGVKTPKVPAPNDIYDLTKPQTVQFGSMKIKMMAPKGSGHTPDNTMILIPSDRVLHFA DMINPDQLPFYNFAGAEHFHGYEEDLQSLLSKPLSKQWDFINGGHGNIGSKQDVKDLLEY IADIRTEVGKQLEVAPYTPVLSDGNHFVWFKRWQDEITNNVHTALANKYGHMYGFDSGVV ETHAAMILADMIDH Click to Show/Hide
Uniprot ID	A0A655YL50_VIBCL
*Click to Show/Hide the Complete Species Lineage*
Kingdom: N.A. Phylum: Proteobacteria Class: Gammaproteobacteria Order: Vibrionales Family: Vibrionaceae Genus: Vibrio Species: Vibrio cholerae

Type(s) of Resistant Mechanism of This Molecule

DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s)

1 drug(s) in total

Click to Show/Hide the Full List of Drugs

Meropenem

Click to Show/Hide

Drug Resistance Data Categorized by Their Corresponding Mechanisms
Drug Inactivation by Structure Modification (DISM)		Click to Show/Hide
Disease Class: Vibrio cholerae infection			[1]
Resistant Disease	Vibrio cholerae infection [ICD-11: 1A00.0]		Disease Info
Resistant Drug	Meropenem		Drug Info
Molecule Alteration	Expression	Inherence
Experimental Note	Discovered Using In-vivo Testing Model
In Vitro Model	Vibrio cholerae CVD101		1854
Mechanism Description	A gel-shift analysis was used to determine if VarR bound to the promoter regions of the resistance genes. Consistent with the regulation of these resistance genes, VarR binds to three distinct intergenic regions, varRG, varGA and varBC located upstream and adjacent to varG, varA and varC, respectively. VarR can act as a repressor at the varRG promoter region; whilst this repression was relieved upon addition of Beta-lactams, these did not dissociate the VarR/varRG-DNA complex, indicating that the de-repression of varR by Beta-lactams is indirect.

References

Ref 1	The Vibrio cholerae var regulon encodes a metallo-Beta-lactamase and an antibiotic efflux pump, which are regulated by VarR, a LysR-type transcription factor. PLoS One. 2017 Sep 12;12(9):e0184255. doi: 10.1371/journal.pone.0184255. eCollection 2017.