Molecule Information

General Information of the Molecule (ID: Mol00842)

• Name: Beta-lactamase (BLA) ,Bacteroides vulgatus
• Molecule Type: Protein
• Gene Name: cfxA
• Sequence:
  MEKNRKKQIVVLSIALVCIFILVFSLFHKSATKDSANPPLTNVLTDSISQIVSACPGEIG
  VAVIVNNRDTVKVNNKSVYPMMSVFKVHQALALCNDFDNKGISLDTLVNINRDKLDPKTW
  SPMLKDYSGPVISLTVRDLLRYTLTQSDNNASNLMFKDMVNVAQTDSFIATLIPRSSFQI
  AYTEEEMSADHNKAYSNYTSPLGAAMLMNRLFTEGLIDDEKQSFIKNTLKECKTGVDRIA
  APLLDKEGVVIAHKTGSGYVNENGVLAAHNDVAYICLPNNISYTLAVFVKDFKGNKSQAS
  QYVAHISAVVYSLLMQTSVKS
• Function: Can hydrolyze cephalosporins, penicillins and also cefoxitin; but at a slow rate.
• Uniprot ID: BLAC_PHOVU

Kingdom: N.A.
Phylum: Bacteroidetes
Class: Bacteroidia
Order: Bacteroidales
Family: Bacteroidaceae
Genus: Phocaeicola
Species: Phocaeicola vulgatus

Type(s) of Resistant Mechanism of This Molecule

  DISM: Drug Inactivation by Structure Modification

Drug Resistance Data Categorized by Drug

Approved Drug(s) 1 drug(s) in total

Cefoxitin

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Drug Inactivation by Structure Modification (DISM)

Disease Class: Bacteroides infection [1]

• Resistant Disease: Bacteroides infection [ICD-11: 1C4Y.7]
• Resistant Drug: Cefoxitin
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli strain HB101; 634468
• In Vitro Model: Escherichia coli strain DH5a; 668369
• In Vitro Model: Bacteroides uniformis strain V528; 820
• In Vitro Model: Bacteroides fragilis strain 638; 862962
• In Vitro Model: Bacteroides fragilis strain IB246; 817
• In Vitro Model: Bacteroides fragilis strain IB246flpSUC2C; 817
• In Vitro Model: Bacteroides fragilis strain IB247; 817
• In Vitro Model: Bacteroides vulgatus strain CLA341; 821
• Experiment for Molecule Alteration: Nucleotide sequence assay
• Experiment for Drug Resistance: Standard broth microdilution method assay
• Mechanism Description: The beta-lactamase gene (cfxA) was subcloned on a 2.2-kb DraI-HindIII fragment, and the nucleotide sequence was determined. These results showed that cfxA encoded a protein of 321 amino acids and 35,375 molecular weight. Mutant strains in which the cfxA structural gene was disrupted by insertional inactivation lost both Fxr and beta-lactamase activity.

References

• Ref 1: Genetic and biochemical analysis of a novel Ambler class A beta-lactamase responsible for cefoxitin resistance in Bacteroides species. Antimicrob Agents Chemother. 1993 May;37(5):1028-36. doi: 10.1128/AAC.37.5.1028.