Molecule Information

General Information of the Molecule (ID: Mol00818)

• Name: Bcr/CflA family efflux transporter (BCML) ,Vibrio cholerae
• Molecule Type: Protein
• Gene Name: floR
• Sequence:
  MTTTRPAWAYTLPAALLLMAPFDILASLAMDIYLPVVPAMPGILNTTPAMIQLTLSLYMV
  MLGVGQVIFGPLSDRIGRRPILLAGATAFVIASLGAAWSSTAPAFVAFRLLQAVGASAML
  VATFATVRDVYANRPEGVVIYGLFSSMLAFVPALGPIAGALIGEFLGWQAIFITLAILAM
  LALLNAGFRWHETRPLDQVKTRRSVLPIFASPAFWVYTVGFSAGMGTFFVFFSTAPRVLI
  GQAEYSEIGFSFAFATVALVMIVTTRFAKSFVARWGIAGCVARGMALLVCGAVLLGIGEL
  YGSPSFLTFILPMWVVAVGIVFTVSVTANGALAEFDDIAGSAVAFYFCVQSLIVSIVGTL
  AVALLNGDTAWPVICYATAMAVLVSLGLVLLRLRGAATEKSPVV
• Uniprot ID: A0A1Y0F4T3_VIBCL

Kingdom: N.A.
Phylum: Proteobacteria
Class: Gammaproteobacteria
Order: Vibrionales
Family: Vibrionaceae
Genus: Vibrio
Species: Vibrio cholerae

Type(s) of Resistant Mechanism of This Molecule

  IDUE: Irregularity in Drug Uptake and Drug Efflux

Drug Resistance Data Categorized by Drug

Approved Drug(s) 2 drug(s) in total

Chloramphenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Pasteurella multocida infection [1]

• Resistant Disease: Pasteurella multocida infection [ICD-11: 1B99.0]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli ATCC 25922; 1322345
• In Vitro Model: Staphylococcus aureus ATCC 29213; 1280
• In Vitro Model: Pasteurella multocida 36950; 1075089
• Experiment for Molecule Alteration: Whole genome sequence assay; Allelic frequency measurement assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: The analysis of one representative P. multocida isolate identified an 82 kb integrative and conjugative element (ICE) integrated into the chromosomal DNA. This ICE, designated ICEPmu1, harboured 11 resistance genes, which confer resistance to streptomycin/spectinomycin (aadA25), streptomycin (strA and strB), gentamicin (aadB), kanamycin/neomycin (aphA1), tetracycline [tetR-tet(H)], chloramphenicol/florfenicol (floR), sulphonamides (sul2), tilmicosin/clindamycin [erm(42)] or tilmicosin/tulathromycin [msr(E)-mph(E)].

Disease Class: Vibrio cholerae infection [2]

• Resistant Disease: Vibrio cholerae infection [ICD-11: 1A00.0]
• Resistant Drug: Chloramphenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Identified from the Human Clinical Data
• In Vitro Model: Escherichia coli DH5alpha; 668369
• In Vitro Model: Escherichia coli k-12 strain TOP10; 83333
• In Vitro Model: Vibrio cholerae O1 C10488; 127906
• In Vitro Model: Vibrio cholerae O1 strain CO943; 127906
• In Vitro Model: Vibrio cholerae O139 1811/98; 45888
• In Vitro Model: Vibrio cholerae O139 2055; 45888
• In Vitro Model: Vibrio cholerae O139 AS207; 45888
• In Vitro Model: Vibrio cholerae O139 E712; 45888
• In Vitro Model: Vibrio cholerae O139 HkO139-SXTS; 45888
• In Vitro Model: Vibrio cholerae O139 strain MO10; 345072
• Experiment for Molecule Alteration: Sequencing assay
• Mechanism Description: Many recent Asian clinical Vibrio cholerae E1 Tor O1 and O139 isolates are resistant to the antibiotics sulfamethoxazole (Su), trimethoprim (Tm), chloramphenicol (Cm), and streptomycin (Sm). The corresponding resistance genes are located on large conjugative elements (SXT constins) that are integrated into prfC on the V. cholerae chromosome. The DNA sequences of the antibiotic resistance genes in the SXT constin in MO10, an O139 isolate. In SXT(MO10), these genes are clustered within a composite transposon-like structure found near the element's 5' end. The genes conferring resistance to Cm (floR), Su (sulII), and Sm (strA and strB) correspond to previously described genes, whereas the gene conferring resistance to Tm, designated dfr18, is novel.

Florfenicol

Drug Resistance Data Categorized by Their Corresponding Mechanisms

Irregularity in Drug Uptake and Drug Efflux (IDUE)

Disease Class: Pasteurella multocida infection [1]

• Resistant Disease: Pasteurella multocida infection [ICD-11: 1B99.0]
• Resistant Drug: Florfenicol
• Molecule Alteration: Expression; Inherence
• Experimental Note: Discovered Using In-vivo Testing Model
• In Vitro Model: Escherichia coli ATCC 25922; 1322345
• In Vitro Model: Staphylococcus aureus ATCC 29213; 1280
• In Vitro Model: Pasteurella multocida 36950; 1075089
• Experiment for Molecule Alteration: Whole genome sequence assay; Allelic frequency measurement assay
• Experiment for Drug Resistance: Broth microdilution method assay
• Mechanism Description: The analysis of one representative P. multocida isolate identified an 82 kb integrative and conjugative element (ICE) integrated into the chromosomal DNA. This ICE, designated ICEPmu1, harboured 11 resistance genes, which confer resistance to streptomycin/spectinomycin (aadA25), streptomycin (strA and strB), gentamicin (aadB), kanamycin/neomycin (aphA1), tetracycline [tetR-tet(H)], chloramphenicol/florfenicol (floR), sulphonamides (sul2), tilmicosin/clindamycin [erm(42)] or tilmicosin/tulathromycin [msr(E)-mph(E)].

References

• Ref 1: ICEPmu1, an integrative conjugative element (ICE) of Pasteurella multocida: analysis of the regions that comprise 12 antimicrobial resistance genes. J Antimicrob Chemother. 2012 Jan;67(1):84-90. doi: 10.1093/jac/dkr406. Epub 2011 Oct 14.
• Ref 2: Molecular analysis of antibiotic resistance gene clusters in vibrio cholerae O139 and O1 SXT constins. Antimicrob Agents Chemother. 2001 Nov;45(11):2991-3000. doi: 10.1128/AAC.45.11.2991-3000.2001.